Recombinant Full Length Mouse Fxyd Domain-Containing Ion Transport Regulator 5(Fxyd5) Protein, His-Tagged
Cat.No. : | RFL7325MF |
Product Overview : | Recombinant Full Length Mouse FXYD domain-containing ion transport regulator 5(Fxyd5) Protein (P97808) (22-178aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (22-178) |
Form : | Lyophilized powder |
AA Sequence : | QTPKKPTSIFTADQTSATTRDNVPDPDQTSPGVQTTPLIWTREEATGSQTAAQTETQQLTKMATSNPVSDPGPHTSSKKGTPAVSRIEPLSPSKNFMPPSYIEHPLDSNENNPFYYDDTTLRKRGLLVAAVLFITGIIILTSGKCRQLSQFCLNRHR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Fxyd5 |
Synonyms | Fxyd5; Oit2; FXYD domain-containing ion transport regulator 5; EF-8; Ion channel homolog RIC; Oncoprotein-induced protein 2 |
UniProt ID | P97808 |
◆ Recombinant Proteins | ||
RFL10382RF | Recombinant Full Length Rat Fxyd Domain-Containing Ion Transport Regulator 5(Fxyd5) Protein, His-Tagged | +Inquiry |
FXYD5-7524H | Recombinant Human FXYD5, His-tagged | +Inquiry |
FXYD5-6107M | Recombinant Mouse FXYD5 Protein | +Inquiry |
FXYD5-2424R | Recombinant Rat FXYD5 Protein | +Inquiry |
FXYD5-3403M | Recombinant Mouse FXYD5 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FXYD5-6098HCL | Recombinant Human FXYD5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Fxyd5 Products
Required fields are marked with *
My Review for All Fxyd5 Products
Required fields are marked with *