| Species : | 
                                    Mus musculus | 
                                
                                
                                    | Source : | 
                                    E.coli | 
                                
                                
                                    | Tag : | 
                                    His | 
                                
                                
                                    | Protein Length : | 
                                    Full Length (1-328) | 
                                
                                
                                    | Form : | 
                                    Lyophilized powder | 
                                
                                
                                    | AA Sequence : | 
                                    MSQPERDNCSFDSVDKLTRTLQLAVHIPTFLLGLVLNLLAIRGFSAFLKKRKLDYIATSI YMINLAVFDLLLVLSLPFKMVLPQVESPLPSFCTLVECLYFISMYGSVFTICFISLDRFL AIQYPILASHLRSPRKTFGICCIIWMLVWIGSIPIYTFHREVERYKCFHNMSDVTWSASV FFPLEIFGFLLPMGIMGFCSYRSIHILLRRPDSTEDWVQQRDTKGLGTKREPCIWTIATN LVIFVVSFLPVHLGFFLQYLVRNRFILDCRMKQGISLFLQLSLCFSNINCCLDVFCYYFV IKEFRMRIKAHRPSTIKLVNQDTMVSRG | 
                                
                                
                                    | Purity : | 
                                    Greater than 90% as determined by SDS-PAGE. | 
                                
                                
                                    | Notes : | 
                                    Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. | 
                                
                                
                                    | Storage : | 
                                    Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. | 
                                
                                
                                    | Storage Buffer : | 
                                    Tris/PBS-based buffer, 6% Trehalose, pH 8.0 | 
                                
                                
                                    | Reconstitution : | 
                                    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |