Recombinant Full Length Mouse High Affinity Immunoglobulin Epsilon Receptor Subunit Gamma(Fcer1G) Protein, His-Tagged
| Cat.No. : | RFL18258MF |
| Product Overview : | Recombinant Full Length Mouse High affinity immunoglobulin epsilon receptor subunit gamma(Fcer1g) Protein (P20491) (19-86aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length of Mature Protein (19-86) |
| Form : | Lyophilized powder |
| AA Sequence : | LGEPQLCYILDAVLFLYGIVLTLLYCRLKIQVRKAAIASREKADAVYTGLNTRSQETYETLKHEKPPQ |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | Fcer1g |
| Synonyms | Fcer1g; Fce1g; High affinity immunoglobulin epsilon receptor subunit gamma; Fc receptor gamma-chain; FcRgamma; Fc-epsilon RI-gamma; IgE Fc receptor subunit gamma; FceRI gamma |
| UniProt ID | P20491 |
| ◆ Recombinant Proteins | ||
| FCER1G-12816H | Recombinant Human FCER1G, GST-tagged | +Inquiry |
| FCER1G-5876Z | Recombinant Zebrafish FCER1G | +Inquiry |
| FCER1G-3182M | Recombinant Mouse FCER1G Protein, His (Fc)-Avi-tagged | +Inquiry |
| FCER1G-196H | Recombinant Human FCER1G, GST-tagged | +Inquiry |
| RFL11405RF | Recombinant Full Length Rat High Affinity Immunoglobulin Epsilon Receptor Subunit Gamma(Fcer1G) Protein, His-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FCER1G-6281HCL | Recombinant Human FCER1G 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Fcer1g Products
Required fields are marked with *
My Review for All Fcer1g Products
Required fields are marked with *
