Recombinant Full Length Mouse Homocysteine-Responsive Endoplasmic Reticulum-Resident Ubiquitin-Like Domain Member 2 Protein(Herpud2) Protein, His-Tagged
Cat.No. : | RFL35891MF |
Product Overview : | Recombinant Full Length Mouse Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 2 protein(Herpud2) Protein (Q9JJC9) (1-404aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-404) |
Form : | Lyophilized powder |
AA Sequence : | MDQSGMEIPVTLIIKAPNQKYSDQTISCFLNWTVGKLKTHLSNVYPSKPLTKDQRLVYSG RLLPDHLQLKDILRKQDEYHMVHLVCASRSPPSSPKSSTDRGSHEALASSTSSNSDHSDS TTPSPSQESLSLVTGSSEGLRQRTLSQAQTDPAQSHQFPYVIQGNVDHQFPGQGVPPAFP VYPALSPLQMLWWQQMYAHQYYMQYQAAVSAQATSSAGSAQRAASSPLNLAHVPGEEPPP APNLVAQENGPMNENVQMNAQGGPVLNEEDLNRDWLDWVYTFSRAAVLLSIVYFYSSFSR FIMVMGAMLLVYLHQAGWFPFRQEGGQQQAPNNVDANNDGHNANNLELEEMERLMDDGLE DESGEDAGEDASAAQRPGLMASAWSFITTFFTSLIPEGPPQVAN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Herpud2 |
Synonyms | Herpud2; MNCb-2040; Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 2 protein |
UniProt ID | Q9JJC9 |
◆ Recombinant Proteins | ||
RFL35044BF | Recombinant Full Length Bovine Homocysteine-Responsive Endoplasmic Reticulum-Resident Ubiquitin-Like Domain Member 2 Protein(Herpud2) Protein, His-Tagged | +Inquiry |
HERPUD2-10534Z | Recombinant Zebrafish HERPUD2 | +Inquiry |
HERPUD2-2828R | Recombinant Rat HERPUD2 Protein | +Inquiry |
HERPUD2-128H | Recombinant Human HERPUD2 protein, His-tagged | +Inquiry |
HERPUD2-4130M | Recombinant Mouse HERPUD2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HERPUD2-5583HCL | Recombinant Human HERPUD2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Herpud2 Products
Required fields are marked with *
My Review for All Herpud2 Products
Required fields are marked with *