Recombinant Full Length Mouse Interferon-Induced Transmembrane Protein 1(Ifitm1) Protein, His-Tagged
| Cat.No. : | RFL27865MF |
| Product Overview : | Recombinant Full Length Mouse Interferon-induced transmembrane protein 1(Ifitm1) Protein (Q9D103) (1-106aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-106) |
| Form : | Lyophilized powder |
| AA Sequence : | MPKEQQEVVVLGSPHISTSATATTINMPEISTPDHVVWSLFNTLFMNFCCLGFVAYAYSV KSRDRKMVGDTTGAQAFASTAKCLNISSLFFTILTAIVVIVVCAIR |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | Ifitm1 |
| Synonyms | Ifitm1; Interferon-induced transmembrane protein 1; Dispanin subfamily A member 2a; DSPA2a; Fragilis protein 2; Mouse ifitm-like protein 2; Mil-2 |
| UniProt ID | Q9D103 |
| ◆ Recombinant Proteins | ||
| IFITM1-4316H | Recombinant Human IFITM1 protein, GST-tagged | +Inquiry |
| IFITM1-4434M | Recombinant Mouse IFITM1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| IFITM1-4220H | Recombinant Human IFITM1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| IFITM1-8017M | Recombinant Mouse IFITM1 Protein | +Inquiry |
| IFITM1-3211H | Recombinant Human IFITM1 Protein (Met1-Phe57), C-SUMO tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IFITM1-5283HCL | Recombinant Human IFITM1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Ifitm1 Products
Required fields are marked with *
My Review for All Ifitm1 Products
Required fields are marked with *



