Recombinant Full Length Mouse Interferon-Induced Transmembrane Protein 5(Ifitm5) Protein, His-Tagged
Cat.No. : | RFL15549MF |
Product Overview : | Recombinant Full Length Mouse Interferon-induced transmembrane protein 5(Ifitm5) Protein (O88728) (1-134aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-134) |
Form : | Lyophilized powder |
AA Sequence : | MDTSYPREDPRAPSSRKADAAAHTALSMGTPGPTPRDHMLWSVFSTMYLNLCCLGFLALV HSVKARDQKMAGNLEAARQYGSKAKCYNILAAMWTLVPPLLLLGLVVTGALHLSKLAKDS AAFFSTKFDEEDYN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Ifitm5 |
Synonyms | Ifitm5; Bril; Fragilis4; Interferon-induced transmembrane protein 5; Bone-restricted interferon-induced transmembrane protein-like protein; Dispanin subfamily A member 1; DSPA1; Fragilis family member 4 |
UniProt ID | O88728 |
◆ Recombinant Proteins | ||
IFITM5-726H | Recombinant Human IFITM5 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
IFITM5-1853HFL | Recombinant Full Length Human IFITM5 Protein, C-Flag-tagged | +Inquiry |
IFITM5-7713Z | Recombinant Zebrafish IFITM5 | +Inquiry |
IFITM5-8021M | Recombinant Mouse IFITM5 Protein | +Inquiry |
IFITM5-4344C | Recombinant Chicken IFITM5 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Ifitm5 Products
Required fields are marked with *
My Review for All Ifitm5 Products
Required fields are marked with *