Recombinant Full Length Mouse L-Selectin(Sell) Protein, His-Tagged
Cat.No. : | RFL33303MF |
Product Overview : | Recombinant Full Length Mouse L-selectin(Sell) Protein (P18337) (39-372aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (39-372) |
Form : | Lyophilized powder |
AA Sequence : | WTYHYSEKPMNWENARKFCKQNYTDLVAIQNKREIEYLENTLPKSPYYYWIGIRKIGKMWTWVGTNKTLTKEAENWGAGEPNNKKSKEDCVEIYIKRERDSGKWNDDACHKRKAALCYTASCQPGSCNGRGECVETINNHTCICDAGYYGPQCQYVVQCEPLEAPELGTMDCIHPLGNFSFQSKCAFNCSEGRELLGTAETQCGASGNWSSPEPICQVVQCEPLEAPELGTMDCIHPLGNFSFQSKCAFNCSEGRELLGTAETQCGASGNWSSPEPICQETNRSFSKIKEGDYNPLFIPVAVMVTAFSGLAFLIWLARRLKKGKKSQERMDDPY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Sell |
Synonyms | Sell; Lnhr; Ly-22; Ly22; L-selectin; CD62 antigen-like family member L; Leukocyte adhesion molecule 1; LAM-1; Leukocyte-endothelial cell adhesion molecule 1; LECAM1; Lymph node homing receptor; Lymphocyte antigen 22; Lymphocyte surface MEL-14 antigen; CD |
UniProt ID | P18337 |
◆ Recombinant Proteins | ||
SELL-2658H | Active Recombinant Human Selectin L | +Inquiry |
SELL-233H | Recombinant Human SELL Protein, His (Fc)-Avi-tagged | +Inquiry |
SELL-0956H | Recombinant Human SELL Protein (Glu109-Ser346), N-GST tagged | +Inquiry |
SELL-96C | Recombinant Cynomolgus SELL protein, His-tagged | +Inquiry |
SELL-1660H | Recombinant Human Selectin L, Fc-His | +Inquiry |
◆ Cell & Tissue Lysates | ||
SELL-1963HCL | Recombinant Human SELL cell lysate | +Inquiry |
SELL-1131CCL | Recombinant Cynomolgus SELL cell lysate | +Inquiry |
SELL-2614MCL | Recombinant Mouse SELL cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Sell Products
Required fields are marked with *
My Review for All Sell Products
Required fields are marked with *