Recombinant Full Length Mouse Lens Fiber Membrane Intrinsic Protein(Lim2) Protein, His-Tagged
| Cat.No. : | RFL23666MF | 
| Product Overview : | Recombinant Full Length Mouse Lens fiber membrane intrinsic protein(Lim2) Protein (P56563) (1-173aa), fused to N-terminal His tag, was expressed in E. coli. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mus musculus | 
| Source : | E.coli | 
| Tag : | His | 
| Protein Length : | Full Length (1-173) | 
| Form : | Lyophilized powder | 
| AA Sequence : | MYSFMGGGLFCAWVGTILLVVATATDHWMQYRLSGSFAHQGLWRYCLGNKCFLQTESIAY WNATRAFMILSALCATSGIIMGVLAFAQQSTFTRLSRPFSAGIMFFASTLFVLLALAIYT GVTVSFLGRRFGDWRFSWSYILGWVALLMTFFAGIFYMCAYRMHECRRLATPR | 
| Purity : | Greater than 90% as determined by SDS-PAGE. | 
| Applications : | SDS-PAGE | 
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. | 
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. | 
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 | 
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. | 
| Gene Name | Lim2 | 
| Synonyms | Lim2; Lens fiber membrane intrinsic protein; MP17; MP18; MP19; MP20 | 
| UniProt ID | P56563 | 
| ◆ Recombinant Proteins | ||
| LIM2-7894H | Recombinant Human LIM2 protein, His & T7-tagged | +Inquiry | 
| LIM2-3409R | Recombinant Rat LIM2 Protein | +Inquiry | 
| LIM2-5082M | Recombinant Mouse LIM2 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| RFL7327RF | Recombinant Full Length Rat Lens Fiber Membrane Intrinsic Protein(Lim2) Protein, His-Tagged | +Inquiry | 
| LIM2-9102M | Recombinant Mouse LIM2 Protein | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| LIM2-4743HCL | Recombinant Human LIM2 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Lim2 Products
Required fields are marked with *
My Review for All Lim2 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            