Recombinant Full Length Mouse Letm1 Domain-Containing Protein Letm2, Mitochondrial(Letm2) Protein, His-Tagged
Cat.No. : | RFL27893MF |
Product Overview : | Recombinant Full Length Mouse LETM1 domain-containing protein LETM2, mitochondrial(Letm2) Protein (Q7TNU7) (26-480aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (26-480) |
Form : | Lyophilized powder |
AA Sequence : | CSHFPSLAFLHLPDSHLRTAYIKNCGSRKYSYPSLTGNNKVHPLRTRLPQKLHTTCWLQH VPGKPQLEQTGKPKAASPQPTKEAKTETTEEKRSLRQKIVNELKYYYKGFSLLWIDTKVA ARIVWRLLHGNALTRRERRRLLRTCADVFRLVPFMVFIIVPFMEFLIPVFLKLFPDMLPS TFESESKKEEKQKKTMAAKLEIAKFLQETMTEMARRNRAKLGDASSQLSSYVKQVQTGHK PSTKEIVRFSKLFKDQLALEHLDRPQLVALCKLLELQTFGTNNLLRFQLLMTLKSIKADD EIIAKEGVKALSVSELQSACRARGMRSLGLTEEQLCQQLTGWLDLHLKENVPPSLLLLSR TFYLIDVKPKPIELPPNIETPKPNLGIPTPPPPESKENLTDSAPQLKGTKDEEFIQLPPV PSSLIAPAATISKEAILQAKSQETSQNSKADSKGA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Letm2 |
Synonyms | Letm2; LETM1 domain-containing protein LETM2, mitochondrial; LETM1 and EF-hand domain-containing protein 2; Leucine zipper-EF-hand-containing transmembrane protein 1-like |
UniProt ID | Q7TNU7 |
◆ Recombinant Proteins | ||
LETM2-3383R | Recombinant Rat LETM2 Protein | +Inquiry |
LETM2-5050M | Recombinant Mouse LETM2 Protein, His (Fc)-Avi-tagged | +Inquiry |
LETM2-6854H | Recombinant Human LETM2 protein, His-tagged | +Inquiry |
RFL33078RF | Recombinant Full Length Rat Letm1 Domain-Containing Protein Letm2, Mitochondrial(Letm2) Protein, His-Tagged | +Inquiry |
LETM2-550H | Recombinant Human LETM2 protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Letm2 Products
Required fields are marked with *
My Review for All Letm2 Products
Required fields are marked with *
0
Inquiry Basket