Recombinant Full Length Mouse LIPE Protein, His tagged

• Cat.No.: LIPE-9128M
• Product Overview: Recombinant Full Length Mouse LIPE Protein (1-759 aa) with His tag was expressed in HEK293.

Specification

• Species: Mouse
• Source: HEK293
• Tag: His
• Protein Length: 1-759 aa
• Description: Enables several functions, including lipase activity; retinyl-palmitate esterase activity; and serine hydrolase activity. Involved in diacylglycerol catabolic process and ether lipid metabolic process. Acts upstream of or within cellular response to cold; long-chain fatty acid catabolic process; and triglyceride catabolic process. Located in cytosol; lipid droplet; and membrane. Is expressed in adipose tissue; ileum; and male reproductive gland or organ. Human ortholog(s) of this gene implicated in arteriosclerosis; familial partial lipodystrophy type 6; and hypertension. Orthologous to human LIPE (lipase E, hormone sensitive type).
• Molecular Mass: 84 kDa
• AA Sequence: HHHHHHHHMDLRTMTQSLVTLAEDNMAFFSSQGPGETARRLSNVFAGVREQALGLEPTLGQLLGVAHHFDLDTETPANGYRSLVHTARCCLAHLLHKSRYVASNRKSIFFRASHNLAELEAYLAALTQLRAMAYYAQRLLTINRPGVLFFEGDEGLTADFLQEYVTLHKGCFYGRCLGFQFTPAIRPFLQTLSIGLVSFGEHYKRNETGLSVTASSLFTGGRFAIDPELRGAEFERIIQNLDVHFWKAFWNITEIEVLSSLANMASTTVRVSRLLSLPPEAFEMPLTSDPRLTVTISPPLAHTGPAPVLARLISYDLREGQDSKVLNSLAKSEGPRLELRPRPHQAPRSRALVVHIHGGGFVAQTSKSHEPYLKNWAQELGVPIFSIDYSLAPEAPFPRALEECFFAYCWAVKHCDLLGSTGERICLAGDSAGGNLCITVSLRAAAYGVRVPDGIMAAYPVTTLQSSASPSRLLSLMDPLLPLSVLSKCVSAYSGTEAEDHFDSDQKALGVMGLVQRDTSLFLRDLRLGASSWLNSFLELSGRKPQKTTSPTAESVRPTESMRRSVSEAALAQPEGLLGTDTLKKLTIKDLSNSEPSDSPEMSQSMETLGPSTPSDVNFFLRPGNSQEEAEAKDEVRPMDGVPRVRAAFPEGFHPRRSSQGVLHMPLYTSPIVKNPFMSPLLAPDSMLKTLPPVHLVACALDPMLDDSVMFARRLRDLGQPVTLKVVEDLPHGFLSLAALCRETRQATEFCVQRIRLILTPPAAPLN
• Endotoxin: < 1 EU/μg by LAL.
• Purity: > 90 % by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Lyophilized from PBS, pH7.4, 5 % Trehalose, 5 % Mannitol
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution. Centrifuge the vial at 4 centigrade before opening to recover the entire contents.

Gene Information

• Gene Name: Lipe lipase, hormone sensitive [ Mus musculus (house mouse) ]
• Official Symbol: LIPE
• Synonyms: LIPE; lipase, hormone sensitive; hormone-sensitive lipase; HSL; 4933403G17Rik
• Gene ID: 16890
• mRNA Refseq: NM_001039507
• Protein Refseq: NP_001034596
• UniProt ID: P54310