Recombinant Full Length Mouse Matrix Metalloproteinase-14(Mmp14) Protein, His-Tagged
Cat.No. : | RFL2938MF |
Product Overview : | Recombinant Full Length Mouse Matrix metalloproteinase-14(Mmp14) Protein (P53690) (112-582aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (112-582) |
Form : | Lyophilized powder |
AA Sequence : | YAIQGLKWQHNEITFCIQNYTPKVGEYATFEAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMILFAEGFHGDSTPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTVQNEDLNGNDIFLVAVHELGHALGLEHSNDPSAIMAPFYQWMDTENFVLPDDDRRGIQQLYGSKSGSPTKMPPQPRTTSRPSVPDKPKNPAYGPNICDGNFDTVAMLRGEMFVFKERWFWRVRNNQVMDGYPMPIGQFWRGLPASINTAYERKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLPTDKIDAALFWMPNGKTYFFRGNKYYRFNEEFRAVDSEYPKNIKVWEGIPESPRGSFMGSDEVFTYFYKGNKYWKFNNQKLKVEPGYPKSALRDWMGCPSGGRPDEGTEEETEVIIIEVDEEGSGAVSAAAVVLPVLLLLLVLAVGLAVFFFRRHGTPKRLLYCQRSLLDKV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Mmp14 |
Synonyms | Mmp14; Mtmmp; Matrix metalloproteinase-14; MMP-14; MMP-X1; MT-MMP; Membrane-type matrix metalloproteinase 1; MT-MMP 1; MTMMP1; Membrane-type-1 matrix metalloproteinase; MT1-MMP; MT1MMP |
UniProt ID | P53690 |
◆ Recombinant Proteins | ||
MMP14-39H | Active Recombinant Human MMP14, His-tagged | +Inquiry |
Mmp14-4098M | Recombinant Mouse Mmp14 Protein, Myc/DDK-tagged | +Inquiry |
Mmp14-9911M | Recombinant Mouse Mmp14 protein, His-tagged | +Inquiry |
MMP14-3233H | Recombinant Human MMP14 protein, His-SUMO-tagged | +Inquiry |
MMP14-3369R | Recombinant Rat MMP14 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MMP14-4279HCL | Recombinant Human MMP14 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Mmp14 Products
Required fields are marked with *
My Review for All Mmp14 Products
Required fields are marked with *
0
Inquiry Basket