Recombinant Full Length Mouse Membrane Progestin Receptor Beta(Paqr8) Protein, His-Tagged
Cat.No. : | RFL805MF |
Product Overview : | Recombinant Full Length Mouse Membrane progestin receptor beta(Paqr8) Protein (Q80ZE5) (1-354aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-354) |
Form : | Lyophilized powder |
AA Sequence : | MTTAILERLSTLSMSGQQLRRLPKILEEGLPKMPCTVPETDVPQLFREPYIHAGYRPTGH EWRYYFFSLFQKHNEVVNVWTHLLAALAVLLRFWAFVEAGALQWASPHTLPLLLFILSSI TYLTCSLLAHLLQSKSELSHYTFYFVDYVGVSVYQYGSALAHFFYSSDQAWYELFWIFFL PAAAFCGWLSCAGCCYAKYRYRRPYPVMRKICQVVPAGLAFVLDISPVAHRVALCHLAGC QEQAAWYHTLQILFFLVSAYFFSCPVPEKYFPGSCDIVGHGHQIFHAFLSVCTLSQLEAI LLDYQGRHEIFLQRHGPLSVYSACLSFFVLAACSAATATLLRHKVKDRLIKKDS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Paqr8 |
Synonyms | Paqr8; Mprb; Membrane progestin receptor beta; mPR beta; Lysosomal membrane protein in brain 1; Membrane progesterone P4 receptor beta; Membrane progesterone receptor beta; Progesterone and adipoQ receptor family member 8; Progestin and adipoQ receptor fa |
UniProt ID | Q80ZE5 |
◆ Recombinant Proteins | ||
PAQR8-3120R | Recombinant Rhesus Macaque PAQR8 Protein, His (Fc)-Avi-tagged | +Inquiry |
PAQR8-1324H | Recombinant Human PAQR8 Protein, GST-Tagged | +Inquiry |
PAQR8-856H | Recombinant Human PAQR8 | +Inquiry |
PAQR8-3794H | Recombinant Human PAQR8 Protein, His (Fc)-Avi-tagged | +Inquiry |
PAQR8-3430HF | Recombinant Full Length Human PAQR8 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PAQR8-3437HCL | Recombinant Human PAQR8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Paqr8 Products
Required fields are marked with *
My Review for All Paqr8 Products
Required fields are marked with *