Recombinant Full Length Mouse Membrane Progestin Receptor Gamma(Paqr5) Protein, His-Tagged
| Cat.No. : | RFL5924MF |
| Product Overview : | Recombinant Full Length Mouse Membrane progestin receptor gamma(Paqr5) Protein (Q9DCU0) (1-330aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-330) |
| Form : | Lyophilized powder |
| AA Sequence : | MLSLKLPRLFRIDQVPQVFHEQGILFGYRHPQSSATACILSLFQMTNETLNIWTHLLPFW FFVWRFMTALYVTDIQNDSYSWPMLVYMCTSCVYPLASSCAHTFSSMSKNARHICYFLDY GAVNLFSLGSAIAYSAYTFPDALVCSTFHECYVALAVLNTILSTGLSCYSRFLELQKPRL CKLLRVLAFAYPYTWDSLPIFYRLFLFPGESSRNEAMLYHQKHMGMTLLASFFYSAHLPE RLAPGRFDYIGHSHQLFHVCVILATHLQMEAILLDKTLRREWLLATSRPFSFPQIAAAML LCIIFSLSNIIYFSAALYRIPEPELHEKET |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | Paqr5 |
| Synonyms | Paqr5; Mprg; Membrane progestin receptor gamma; mPR gamma; Membrane progesterone P4 receptor gamma; Membrane progesterone receptor gamma; Progesterone and adipoQ receptor family member 5; Progestin and adipoQ receptor family member 5; Progestin and adipoQ |
| UniProt ID | Q9DCU0 |
| ◆ Recombinant Proteins | ||
| PAQR5-6492M | Recombinant Mouse PAQR5 Protein, His (Fc)-Avi-tagged | +Inquiry |
| PAQR5-1525H | Recombinant Human PAQR5, GST-tagged | +Inquiry |
| RFL25003HF | Recombinant Full Length Human Membrane Progestin Receptor Gamma(Paqr5) Protein, His-Tagged | +Inquiry |
| PAQR5-12351M | Recombinant Mouse PAQR5 Protein | +Inquiry |
| RFL5924MF | Recombinant Full Length Mouse Membrane Progestin Receptor Gamma(Paqr5) Protein, His-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PAQR5-3438HCL | Recombinant Human PAQR5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Paqr5 Products
Required fields are marked with *
My Review for All Paqr5 Products
Required fields are marked with *




