Recombinant Full Length Mouse Natural Killer Cells Antigen Cd94(Klrd1) Protein, His-Tagged
Cat.No. : | RFL32586MF |
Product Overview : | Recombinant Full Length Mouse Natural killer cells antigen CD94(Klrd1) Protein (O54707) (1-179aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-179) |
Form : | Lyophilized powder |
AA Sequence : | MAVSRITRWRLMSVIFGIKCLFLMVTLGVLLINSFTIQNIQSTPSPTTTVEFQEVSECCVCLDKWVGHQCNCYFISKEEKSWKRSRDFCASQNSSLLQPQSRNELSFMNFSQTFFWIGMHYSEKRNAWLWEDGTVPSKDLFPEFSVIRPEHCIVYSPSKSVSAESCENKNRYICKKLPI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Klrd1 |
Synonyms | Klrd1; Cd94; Natural killer cells antigen CD94; Killer cell lectin-like receptor subfamily D member 1; CD antigen CD94 |
UniProt ID | O54707 |
◆ Recombinant Proteins | ||
KLRD1-222H | Recombinant Human KLRD1 Protein, His-tagged | +Inquiry |
KLRD1-2259R | Recombinant Rhesus Macaque KLRD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
KLRD1-4888M | Recombinant Mouse KLRD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
KLRD1-089H | Recombinant Human KLRD1 Protein, His-tagged | +Inquiry |
KLRD1-2381H | Recombinant Human KLRD1 protein(Lys32-Ile179), hFc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KLRD1-4893HCL | Recombinant Human KLRD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Klrd1 Products
Required fields are marked with *
My Review for All Klrd1 Products
Required fields are marked with *
0
Inquiry Basket