Recombinant Full Length Mouse Neuronal Membrane Glycoprotein M6-B(Gpm6B) Protein, His-Tagged
Cat.No. : | RFL2639MF |
Product Overview : | Recombinant Full Length Mouse Neuronal membrane glycoprotein M6-b(Gpm6b) Protein (P35803) (1-328aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-328) |
Form : | Lyophilized powder |
AA Sequence : | MKPAMETAAEENTEQSQERKVNSRAEMEIGRYHWMYPGSKNHQYRPVPNLGDRAGPLSSP GCFECCIKCLGGVPYASLVATILCFSGVALFCGCGHVALAGTVAILEQHFSTNTSDHALL SEVIQLMQYVIYGIASFFFLYGIILLAEGFYTTSAVKELHGEFKTTACGRCISGMFVFLT YVLGVAWLGVFGFSAVPVFMFYNIWSTCEVIKSPQSNGTSGVEQICVDVRQYGIIPWNAF PGKICGSALENICNTNEFYMSYHLFIVACAGAGATVIALIHFLMILSSNWAYLKDASKMQ AYQDIKAKEEQELQDIQSRSKEQLNSYT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Gpm6b |
Synonyms | Gpm6b; M6b; Neuronal membrane glycoprotein M6-b; M6b |
UniProt ID | P35803 |
◆ Recombinant Proteins | ||
GPM6B-5553HF | Recombinant Full Length Human GPM6B Protein, GST-tagged | +Inquiry |
GPM6B-5161H | Recombinant Human GPM6B Protein, GST-tagged | +Inquiry |
GPM6B-2296R | Recombinant Rat GPM6B Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL12432HF | Recombinant Full Length Human Neuronal Membrane Glycoprotein M6-B(Gpm6B) Protein, His-Tagged | +Inquiry |
GPM6B-1937R | Recombinant Rhesus monkey GPM6B Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GPM6B-304HCL | Recombinant Human GPM6B lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Gpm6b Products
Required fields are marked with *
My Review for All Gpm6b Products
Required fields are marked with *
0
Inquiry Basket