Recombinant Full Length Mouse Neuropeptide Y Receptor Type 2(Npy2R) Protein, His-Tagged
Cat.No. : | RFL23781MF |
Product Overview : | Recombinant Full Length Mouse Neuropeptide Y receptor type 2(Npy2r) Protein (P97295) (1-385aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-385) |
Form : | Lyophilized powder |
AA Sequence : | MVLKMGPVGAEADENQTVEVKVEPYGPGHTTPRGELPPDPEPELIDSTKLVEVQVILILA YCSIILLGVVGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLTYTLMGEW KMGPVLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKRISFLIIGLAWGIS ALLASPLAIFREYSLIEIIPDFEIVACTEKWPGEEKSVYGTVYSLSTLLILYVLPLGIIS FSYTRIWSKLRNHVSPGAASDHYHQRRHKMTKMLVCVVVVFAVSWLPLHAFQLAVDIDSH VLDLKEYKLIFTVFHIIAMCSTFANPLLYGWMNSNYRKAFLSAFRCEQRLDAIHSEVSMT FKAKKNLEVKKNNGPTDSFSEATNV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Npy2r |
Synonyms | Npy2r; Neuropeptide Y receptor type 2; NPY2-R; NPY-Y2 receptor; Y2 receptor |
UniProt ID | P97295 |
◆ Recombinant Proteins | ||
NPY2R-3671H | Recombinant Human NPY2R Protein, His (Fc)-Avi-tagged | +Inquiry |
Npy2r-3289M | Recombinant Mouse Npy2r protein, His-tagged | +Inquiry |
RFL11780MF | Recombinant Full Length Macaca Mulatta Neuropeptide Y Receptor Type 2(Npy2R) Protein, His-Tagged | +Inquiry |
NPY2R-295H | Recombinant Human NPY2R | +Inquiry |
NPY2R-2569M | Recombinant Mouse NPY2R Protein (1-51 aa), His-SUMO-Myc-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Npy2r Products
Required fields are marked with *
My Review for All Npy2r Products
Required fields are marked with *
0
Inquiry Basket