Recombinant Mouse Npy2r protein, His-tagged
| Cat.No. : | Npy2r-3289M |
| Product Overview : | Recombinant Mouse Npy2r protein(P97295)(1-51aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-51aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 11.0 kDa |
| AA Sequence : | MGPVGAEADENQTVEVKVEPYGPGHTTPRGELPPDPEPELIDSTKLVEVQV |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | Npy2r neuropeptide Y receptor Y2 [ Mus musculus ] |
| Official Symbol | Npy2r |
| Synonyms | NPY2R; neuropeptide Y receptor Y2; neuropeptide Y receptor type 2; Y2 receptor; NPY-Y2 receptor; NPY2-R; MGC124241; MGC124242; MGC124244; |
| Gene ID | 18167 |
| mRNA Refseq | NM_001205099 |
| Protein Refseq | NP_001192028 |
| ◆ Recombinant Proteins | ||
| NPY2R-3671H | Recombinant Human NPY2R Protein, His (Fc)-Avi-tagged | +Inquiry |
| NPY2R-2800C | Recombinant Chicken NPY2R | +Inquiry |
| Npy2r-3289M | Recombinant Mouse Npy2r protein, His-tagged | +Inquiry |
| RFL32673HF | Recombinant Full Length Human Neuropeptide Y Receptor Type 2(Npy2R) Protein, His-Tagged | +Inquiry |
| NPY2R-8854H | Recombinant Human NPY2R protein, His-SUMO-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Npy2r Products
Required fields are marked with *
My Review for All Npy2r Products
Required fields are marked with *
