| Species : |
Mouse |
| Source : |
E.coli |
| Tag : |
His |
| Protein Length : |
1-264 aa |
| Description : |
Enables nicotinamide N-methyltransferase activity. Involved in NAD catabolic process; nicotinamide metabolic process; and positive regulation of metabolic process. Acts upstream of or within methylation. Is active in cytosol. Is expressed in brown fat. Human ortholog(s) of this gene implicated in abdominal aortic aneurysm. Orthologous to human NNMT (nicotinamide N-methyltransferase). |
| Form : |
Liquid in 20mM Tris-HCl buffer (pH 8.0) containing 10% glycerol, 1mM DTT |
| Molecular Mass : |
32.1 kDa (288aa) confirmed by MALDI-TOF |
| AASequence : |
MGSSHHHHHHSSGLVPRGSHMGSHMESGFTSKDTYLSHFNPRDYLEKYYSFGSRHCAENEILRHLLKNLFKIFCLGAVKGELLIDIGSGPTIYQLLSACESFTEIIVSDYTDQNLWELQKWLKKEPGAFDWSPVVTYVCDLEGNRMKGPEKEEKLRRAIKQVLKCDVTQSQPLGGVSLPPADCLLSTLCLDAACPDLPAYRTALRNLGSLLKPGGFLVMVDALKSSYYMIGEQKFSSLPLGWETVRDAVEEAGYTIEQFEVISQNYSSTTSNNEGLFSLVGRKPGRSE |
| Endotoxin : |
Specific activity is > 100 nmol/min/mg, and is defined as the amount of enzyme that transfer 1.0 nmole of methyl group per minute at 37 centigrade. |
| Purity : |
> 90% by SDS-PAGE |
| Applications : |
SDS-PAGE |
| Notes : |
For research use only. This product is not intended or approved for human, diagnostics or veterinary use. |
| Storage : |
Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
| Concentration : |
1 mg/mL (determined by absorbance at 280nm) |
