Recombinant Full Length Mouse Ox-2 Membrane Glycoprotein(Cd200) Protein, His-Tagged
| Cat.No. : | RFL15946MF |
| Product Overview : | Recombinant Full Length Mouse OX-2 membrane glycoprotein(Cd200) Protein (O54901) (31-278aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (31-278) |
| Form : | Lyophilized powder |
| AA Sequence : | QVEVVTQDERKALHTTASLRCSLKTSQEPLIVTWQKKKAVSPENMVTYSKTHGVVIQPAYKDRINVTELGLWNSSITFWNTTLEDEGCYMCLFNTFGSQKVSGTACLTLYVQPIVHLHYNYFEDHLNITCSATARPAPAISWKGTGTGIENSTESHFHSNGTTSVTSILRVKDPKTQVGKEVICQVLYLGNVIDYKQSLDKGFWFSVPLLLSIVSLVILLVLISILLYWKRHRNQERGESSQGMQRMK |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | Cd200 |
| Synonyms | Cd200; Mox2; OX-2 membrane glycoprotein; MRC OX-2 antigen; CD antigen CD200 |
| UniProt ID | O54901 |
| ◆ Recombinant Proteins | ||
| CD200-133H | Recombinant Human CD200 Protein, His-tagged | +Inquiry |
| CD200-0741H | Recombinant Human CD200 Protein | +Inquiry |
| CD200-630H | Active Recombinant Human CD200 protein, His-tagged | +Inquiry |
| CD200-305H | Recombinant Human CD200 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
| Cd200-001M | Active Recombinant Mouse Cd200, MIgG2a Fc-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CD200-2707HCL | Recombinant Human CD200 cell lysate | +Inquiry |
| CD200-2638MCL | Recombinant Mouse CD200 cell lysate | +Inquiry |
| CD200-1041CCL | Recombinant Cynomolgus CD200 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Cd200 Products
Required fields are marked with *
My Review for All Cd200 Products
Required fields are marked with *
