Recombinant Full Length Mouse Ox-2 Membrane Glycoprotein(Cd200) Protein, His-Tagged
Cat.No. : | RFL15946MF |
Product Overview : | Recombinant Full Length Mouse OX-2 membrane glycoprotein(Cd200) Protein (O54901) (31-278aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (31-278) |
Form : | Lyophilized powder |
AA Sequence : | QVEVVTQDERKALHTTASLRCSLKTSQEPLIVTWQKKKAVSPENMVTYSKTHGVVIQPAYKDRINVTELGLWNSSITFWNTTLEDEGCYMCLFNTFGSQKVSGTACLTLYVQPIVHLHYNYFEDHLNITCSATARPAPAISWKGTGTGIENSTESHFHSNGTTSVTSILRVKDPKTQVGKEVICQVLYLGNVIDYKQSLDKGFWFSVPLLLSIVSLVILLVLISILLYWKRHRNQERGESSQGMQRMK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Cd200 |
Synonyms | Cd200; Mox2; OX-2 membrane glycoprotein; MRC OX-2 antigen; CD antigen CD200 |
UniProt ID | O54901 |
◆ Recombinant Proteins | ||
RFL12833CF | Recombinant Full Length Capsella Bursa-Pastoris Chloroplast Envelope Membrane Protein(Cema) Protein, His-Tagged | +Inquiry |
TLR8-930H | Recombinant Human TLR8 protein, His-tagged | +Inquiry |
XG-694H | Recombinant Human XG protein, mFc-tagged | +Inquiry |
POLL-543C | Recombinant Cynomolgus Monkey POLL Protein, His (Fc)-Avi-tagged | +Inquiry |
WDR11-789H | Recombinant Human WDR11 | +Inquiry |
◆ Native Proteins | ||
FABP-174M | Native Cynomolgus Monkey Fatty acid Binding Protein | +Inquiry |
FGG -57R | Native Rabbit Fibrinogen, FITC Labeled | +Inquiry |
C2-98H | Active Native Human C2 Protein | +Inquiry |
Hemocyanin-31S | Native Shrimp hemocyanin Protein, a substitute for KLH, animal free, SMCC Activated | +Inquiry |
GGT1-8131H | Native Human Liver Gamma Glutamyl Transpeptidase | +Inquiry |
◆ Cell & Tissue Lysates | ||
FKBP8-6202HCL | Recombinant Human FKBP8 293 Cell Lysate | +Inquiry |
EMID1-6610HCL | Recombinant Human EMID1 293 Cell Lysate | +Inquiry |
CDC42BPA-7654HCL | Recombinant Human CDC42BPA 293 Cell Lysate | +Inquiry |
LDLR-2762MCL | Recombinant Mouse LDLR cell lysate | +Inquiry |
GAD1-586HCL | Recombinant Human GAD1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Cd200 Products
Required fields are marked with *
My Review for All Cd200 Products
Required fields are marked with *
0
Inquiry Basket