Recombinant Full Length Mouse Ox-2 Membrane Glycoprotein(Cd200) Protein, His-Tagged
Cat.No. : | RFL15946MF |
Product Overview : | Recombinant Full Length Mouse OX-2 membrane glycoprotein(Cd200) Protein (O54901) (31-278aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (31-278) |
Form : | Lyophilized powder |
AA Sequence : | QVEVVTQDERKALHTTASLRCSLKTSQEPLIVTWQKKKAVSPENMVTYSKTHGVVIQPAYKDRINVTELGLWNSSITFWNTTLEDEGCYMCLFNTFGSQKVSGTACLTLYVQPIVHLHYNYFEDHLNITCSATARPAPAISWKGTGTGIENSTESHFHSNGTTSVTSILRVKDPKTQVGKEVICQVLYLGNVIDYKQSLDKGFWFSVPLLLSIVSLVILLVLISILLYWKRHRNQERGESSQGMQRMK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Cd200 |
Synonyms | Cd200; Mox2; OX-2 membrane glycoprotein; MRC OX-2 antigen; CD antigen CD200 |
UniProt ID | O54901 |
◆ Recombinant Proteins | ||
CD200-4587H | Recombinant Human CD200 Protein (Met1-Gly232), C-His tagged | +Inquiry |
CD200-202H | Recombinant Human CD200, His-tagged | +Inquiry |
Cd200-392M | Recombinant Mouse Cd200 protein(31-232aa), His&Myc-tagged | +Inquiry |
CD200-223H | Active Recombinant Human CD200, HIgG1 Fc-tagged, mutant | +Inquiry |
CD200-213H | Recombinant Human CD200 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD200-2707HCL | Recombinant Human CD200 cell lysate | +Inquiry |
CD200-2638MCL | Recombinant Mouse CD200 cell lysate | +Inquiry |
CD200-1041CCL | Recombinant Cynomolgus CD200 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Cd200 Products
Required fields are marked with *
My Review for All Cd200 Products
Required fields are marked with *