Recombinant Full Length Mouse Pdzk1-Interacting Protein 1(Pdzk1Ip1) Protein, His-Tagged
| Cat.No. : | RFL22704MF |
| Product Overview : | Recombinant Full Length Mouse PDZK1-interacting protein 1(Pdzk1ip1) Protein (Q9CQH0) (1-114aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-114) |
| Form : | Lyophilized powder |
| AA Sequence : | MLAFSLLVLGLLAEVAPASCQQGLGNLQPWMQGLIAVAVFLVLVAIVFAVNHFWCQEEPE PGSTVMIIGNKADGVLVGMDGRYSSMASGFRSSEHKNAYENVLEEEGRVRSTPM |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | Pdzk1ip1 |
| Synonyms | Pdzk1ip1; Map17; PDZK1-interacting protein 1; 17 kDa membrane-associated protein |
| UniProt ID | Q9CQH0 |
| ◆ Recombinant Proteins | ||
| RFL3753SF | Recombinant Full Length Pig Pdzk1-Interacting Protein 1(Pdzk1Ip1) Protein, His-Tagged | +Inquiry |
| PDZK1IP1-3366R | Recombinant Rhesus monkey PDZK1IP1 Protein, His-tagged | +Inquiry |
| PDZK1IP1-3184R | Recombinant Rhesus Macaque PDZK1IP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| RFL22704MF | Recombinant Full Length Mouse Pdzk1-Interacting Protein 1(Pdzk1Ip1) Protein, His-Tagged | +Inquiry |
| Pdzk1ip1-4785M | Recombinant Mouse Pdzk1ip1 Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PDZK1IP1-3313HCL | Recombinant Human PDZK1IP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Pdzk1ip1 Products
Required fields are marked with *
My Review for All Pdzk1ip1 Products
Required fields are marked with *
