Recombinant Full Length Mouse Peptidyl-Prolyl Cis-Trans Isomerase Fkbp11(Fkbp11) Protein, His-Tagged
| Cat.No. : | RFL32885MF |
| Product Overview : | Recombinant Full Length Mouse Peptidyl-prolyl cis-trans isomerase FKBP11(Fkbp11) Protein (Q9D1M7) (28-201aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mus musculus |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length of Mature Protein (28-201) |
| Form : | Lyophilized powder |
| AA Sequence : | GPETESPVRTLQVETLVQPPESCTESAAIGDTLHIHYTGSLVDGRIIDTSLTRDPLVIEL GQKQVIPGLEQSLLDMCVGEKRRAVIPSHLAYGKRGYPPSIPADAVVQYDVELIALIRAN YWQKLLKSILPLVGIAMVPALLGLIGYHLYRKASRPKVSKKKLKEEKRNKSKKK |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | Fkbp11 |
| Synonyms | Fkbp11; Peptidyl-prolyl cis-trans isomerase FKBP11; PPIase FKBP11; 19 kDa FK506-binding protein; 19 kDa FKBP; FKBP-19; FK506-binding protein 11; FKBP-11; Rotamase |
| UniProt ID | Q9D1M7 |
| ◆ Recombinant Proteins | ||
| FKBP11-12907H | Recombinant Human FKBP11, GST-tagged | +Inquiry |
| FKBP11-565H | Recombinant Human FKBP11 Protein, Fc-tagged | +Inquiry |
| FKBP11-4184H | Recombinant Human FKBP11 Protein, GST-tagged | +Inquiry |
| FKBP11-5901M | Recombinant Mouse FKBP11 Protein | +Inquiry |
| Fkbp11-3020M | Recombinant Mouse Fkbp11 Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FKBP11-6212HCL | Recombinant Human FKBP11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Fkbp11 Products
Required fields are marked with *
My Review for All Fkbp11 Products
Required fields are marked with *
