Recombinant Full Length Mouse Phospholipid Scramblase 4(Plscr4) Protein, His-Tagged
Cat.No. : | RFL3196MF |
Product Overview : | Recombinant Full Length Mouse Phospholipid scramblase 4(Plscr4) Protein (P58196) (1-326aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-326) |
Form : | Lyophilized powder |
AA Sequence : | MSGLVPTAPEQPTEEMENQIKSPTAVPDAPPDYNSHFAPGPAGPVASPSAGLPMGYYIPQQPGAIPLYHPTGGTHPIQYQPGKYPVTNQPAPIMWMAGPAPVPNCPPGLEYLAQLDNIHVLQHVEPLELMTRFETNNRYDIKNNIDQMVYIVTEDTDDFTRNAYRNLRPFVLRVTDCLGREIMTMQRPFRCTCCCFCCPCARQELEVQCPPGVTIGFVAEHWNLCRASYSIQNEKKESMMRVRGPCATYGCGSDSVFEINSLDGVSNIGSIIRKWNGFLSTMVNADHFEIRFPLALDVKMKAMIFGSCFLIDFMYFERPPPRRMSR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Plscr4 |
Synonyms | Plscr4; Phospholipid scramblase 4; PL scramblase 4; Ca(2+-dependent phospholipid scramblase 4 |
UniProt ID | P58196 |
◆ Recombinant Proteins | ||
RFL3196MF | Recombinant Full Length Mouse Phospholipid Scramblase 4(Plscr4) Protein, His-Tagged | +Inquiry |
Plscr4-1952M | Recombinant Mouse Plscr4 Protein, His&GST-tagged | +Inquiry |
Plscr4-4943M | Recombinant Mouse Plscr4 Protein, Myc/DDK-tagged | +Inquiry |
PLSCR4-5032H | Recombinant Human PLSCR4 Protein (Met1-Lys303), N-His tagged | +Inquiry |
PLSCR4-3298R | Recombinant Rhesus Macaque PLSCR4 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PLSCR4-3094HCL | Recombinant Human PLSCR4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Plscr4 Products
Required fields are marked with *
My Review for All Plscr4 Products
Required fields are marked with *