Recombinant Full Length Mouse Prostaglandin E Synthase(Ptges) Protein, His-Tagged
| Cat.No. : | RFL27653MF |
| Product Overview : | Recombinant Full Length Mouse Prostaglandin E synthase(Ptges) Protein (Q9JM51) (1-153aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-153) |
| Form : | Lyophilized powder |
| AA Sequence : | MPSPGLVMESGQVLPAFLLCSTLLVIKMYAVAVITGQMRLRKKAFANPEDALKRGGLQYY RSDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPLIAWIHFLVVLTGRVVHTVAYLG KLNPRLRSGAYVLAQFSCFSMALQILWEVAHHL |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | Ptges |
| Synonyms | Ptges; Pges; Prostaglandin E synthase; mPGES-1; Glutathione peroxidase PTGES; Glutathione transferase PTGES; Microsomal prostaglandin E synthase 1 |
| UniProt ID | Q9JM51 |
| ◆ Recombinant Proteins | ||
| Ptges-1999R | Recombinant Rat Ptges Protein, His-tagged | +Inquiry |
| PTGES-32H | Recombinant Full Length Human PTGES protein, MYC/DDK-tagged | +Inquiry |
| PTGES-145H | Recombinant Human PTGES Protein, His/GST-tagged | +Inquiry |
| PTGES-1247H | Recombinant Full Length Human PTGES Protein (M1-L152 end), His tagged | +Inquiry |
| PTGES-11H | Recombinant Human PTGES-3C-eGFP Protein (M1-L152 end), C-10×His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PTGES-2715HCL | Recombinant Human PTGES 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Ptges Products
Required fields are marked with *
My Review for All Ptges Products
Required fields are marked with *
