Recombinant Full Length Mouse Protein Fam162A(Fam162A) Protein, His-Tagged
| Cat.No. : | RFL3908MF |
| Product Overview : | Recombinant Full Length Mouse Protein FAM162A(Fam162a) Protein (Q9D6U8) (1-155aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mus musculus |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-155) |
| Form : | Lyophilized powder |
| AA Sequence : | MWSLGGLRLAAGHCLRLYERNASSSLRFTRNTDLKRINGFCTKPQESPKTPTQSYRHGVP LHKPTDFEKKILLWSGRFKKEEEIPETISFEMLDAAKNKLRVKVSYLMIALTVAGCIYMV IEGKKAAKRHESLTSLNLERKARLREEAAMKAKTD |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | Fam162a |
| Synonyms | Fam162a; E2ig5; Protein FAM162A; E2-induced gene 5 protein homolog; Growth and transformation-dependent protein; HGTD-P |
| UniProt ID | Q9D6U8 |
| ◆ Recombinant Proteins | ||
| FAM162A-3002M | Recombinant Mouse FAM162A Protein, His (Fc)-Avi-tagged | +Inquiry |
| RFL3908MF | Recombinant Full Length Mouse Protein Fam162A(Fam162A) Protein, His-Tagged | +Inquiry |
| FAM162A-5499Z | Recombinant Zebrafish FAM162A | +Inquiry |
| RFL21680PF | Recombinant Full Length Pongo Abelii Protein Fam162A(Fam162A) Protein, His-Tagged | +Inquiry |
| Fam162a-2923M | Recombinant Mouse Fam162a Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FAM162A-6416HCL | Recombinant Human FAM162A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Fam162a Products
Required fields are marked with *
My Review for All Fam162a Products
Required fields are marked with *
