Recombinant Full Length Mouse Protein Fam173B(Fam173B) Protein, His-Tagged
Cat.No. : | RFL15912MF |
Product Overview : | Recombinant Full Length Mouse Protein FAM173B(Fam173b) Protein (Q9D1Z3) (1-247aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-247) |
Form : | Lyophilized powder |
AA Sequence : | MERVGTPEEERQAGPVLPTSLESDSSKRTSWGFLITGVVGGALLTVYAVATPFITPALRK VCLPFVPATSKQVENVVRMLRHRRGPLVDIGSGDGRIVIAAAKEGFPAVGYELNPWLVWY SRYRAWRAGVHGSAKFYISDLWKVTFAQYSNVVIFGVPQMMPQLEKKLELELEDGARVIA CRFPFPRWTPDHTTGEGIDTVWAYDMSAQRGRGGRPNQEWVGQKNLSETAGLQASSSETR SKLLDVE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Fam173b |
Synonyms | Atpsckmt; Fam173b; ATP synthase subunit C lysine N-methyltransferase; Protein N-lysine methyltransferase FAM173B; mFam173b |
UniProt ID | Q9D1Z3 |
◆ Recombinant Proteins | ||
RFL6719XF | Recombinant Full Length Xenopus Laevis Protein Fam173B(Fam173B) Protein, His-Tagged | +Inquiry |
FAM173B-3013M | Recombinant Mouse FAM173B Protein, His (Fc)-Avi-tagged | +Inquiry |
FAM173B-5533M | Recombinant Mouse FAM173B Protein | +Inquiry |
RFL15912MF | Recombinant Full Length Mouse Protein Fam173B(Fam173B) Protein, His-Tagged | +Inquiry |
FAM173B-8443Z | Recombinant Zebrafish FAM173B | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAM173B-6406HCL | Recombinant Human FAM173B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Fam173b Products
Required fields are marked with *
My Review for All Fam173b Products
Required fields are marked with *
0
Inquiry Basket