Recombinant Full Length Mouse Protein Tweety Homolog 2(Ttyh2) Protein, His-Tagged
Cat.No. : | RFL1236MF |
Product Overview : | Recombinant Full Length Mouse Protein tweety homolog 2(Ttyh2) Protein (Q3TH73) (407-532aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (407-532) |
Form : | Lyophilized powder |
AA Sequence : | TCAGPRAWKYFINRDRDYDDIDDDDPFNPQARRIAAHNPTRGQLHSFCSYSSGLGSQCSL QPPSQTISNAPVSEYMNQAILFGGNPRYENVPLIGRGSPPPTYSPSMRPTYMSVADEHLR HYEFPS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Ttyh2 |
Synonyms | Ttyh2; Protein tweety homolog 2; mTTY2 |
UniProt ID | Q3TH73 |
◆ Recombinant Proteins | ||
TTYH2-17605M | Recombinant Mouse TTYH2 Protein | +Inquiry |
TTYH2-9749M | Recombinant Mouse TTYH2 Protein, His (Fc)-Avi-tagged | +Inquiry |
TTYH2-618Z | Recombinant Zebrafish TTYH2 | +Inquiry |
Ttyh2-597M | Recombinant Mouse Ttyh2 Protein, MYC/DDK-tagged | +Inquiry |
RFL29830XF | Recombinant Full Length Xenopus Tropicalis Protein Tweety Homolog 2(Ttyh2) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TTYH2-663HCL | Recombinant Human TTYH2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Ttyh2 Products
Required fields are marked with *
My Review for All Ttyh2 Products
Required fields are marked with *