Recombinant Full Length Mouse Protein Yif1B(Yif1B) Protein, His-Tagged
Cat.No. : | RFL25234MF |
Product Overview : | Recombinant Full Length Mouse Protein YIF1B(Yif1b) Protein (Q9CX30) (1-311aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-311) |
Form : | Lyophilized powder |
AA Sequence : | MHATGLAAPAGTPRLRKWPSKRRVPVSQPGMADPHQFFDDTSSAPSRGYGGQPSPGGLGY PPSSSDAAFLAAPMSNMAMVYGSSLAAQGKELVDKNIDRFIPVSKLKYYFAVDTVYVGKK LGLLVFPYLHQDWEVQYQQDTPVAPRFDINAPDLYIPAMAFITYILVAGLALGTQDRFSP DLLGLQASSALAWLTLEVVAILLSLYLVTVNTDLTTIDLVAFLGYKYVGMIGGVLTGLLF GKIGYYLVLAWCCVSIFVFMIRTLRLKILAQAAAEGVPVRGARNQLRMYLTMAVAAAQPV LMYWLTFHLVR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Yif1b |
Synonyms | Yif1b; Protein YIF1B; YIP1-interacting factor homolog B |
UniProt ID | Q9CX30 |
◆ Recombinant Proteins | ||
YIF1B-18659M | Recombinant Mouse YIF1B Protein | +Inquiry |
YIF1B-194H | Recombinant Human YIF1B, His-tagged | +Inquiry |
RFL23265XF | Recombinant Full Length Xenopus Tropicalis Protein Yif1B(Yif1B) Protein, His-Tagged | +Inquiry |
RFL1415DF | Recombinant Full Length Danio Rerio Protein Yif1B(Yif1B) Protein, His-Tagged | +Inquiry |
RFL5848RF | Recombinant Full Length Rat Protein Yif1B(Yif1B) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
YIF1B-246HCL | Recombinant Human YIF1B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Yif1b Products
Required fields are marked with *
My Review for All Yif1b Products
Required fields are marked with *
0
Inquiry Basket