Recombinant Full Length Mouse Proteinase-Activated Receptor 3(F2Rl2) Protein, His-Tagged
Cat.No. : | RFL26752MF |
Product Overview : | Recombinant Full Length Mouse Proteinase-activated receptor 3(F2rl2) Protein (O08675) (38-369aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (38-369) |
Form : | Lyophilized powder |
AA Sequence : | SFNGGPQNTFEEFPLSDIEGWTGATTTIKAECPEDSISTLHVNNATIGYLRSSLSTQVIP AIYILLFVVGVPANIVTLWKLSLRTKSISLVIFHTNLAIADLLFCVTLPFKIAYHLNGNN WVFGEVTCRITTVVFYGNMYCAILILTCMGINRYLATAHPFTYQKLPKRSFSMLMCGMVW VMVFLYMLPFVILKQEYHLVHSEITTCHDVVDACESPSSFRFYYFVSLAFFGFLIPFVII IFCYTTLIHKLKSKDRIWLGYIKAVLLILVIFTICFAPTNIILVIHHANYYYHNTDSLYF MYLIALCLGSLNSCLDPFLYFVMSKVVDQLNP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | F2rl2 |
Synonyms | F2rl2; Par3; Proteinase-activated receptor 3; PAR-3; Coagulation factor II receptor-like 2; Thrombin receptor-like 2 |
UniProt ID | O08675 |
◆ Recombinant Proteins | ||
F2RL2-2178R | Recombinant Rat F2RL2 Protein | +Inquiry |
F2RL2-9128H | Recombinant Human F2RL2 Full Length Transmembrane protein, His-tagged | +Inquiry |
RFL16674HF | Recombinant Full Length Human Proteinase-Activated Receptor 3(F2Rl2) Protein, His-Tagged | +Inquiry |
F2RL2-1835R | Recombinant Rat F2RL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
F2RL2-3617H | Recombinant Human F2RL2 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All F2rl2 Products
Required fields are marked with *
My Review for All F2rl2 Products
Required fields are marked with *
0
Inquiry Basket