Recombinant Full Length Mouse Rapsn Protein, His-tagged

Cat.No. : Rapsn-7312M
Product Overview : Recombinant mouse RAPSN protein, fused to His-tag at N-terminus, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Protein Length : 1-412
Description : Postsynaptic protein required for clustering of nicotinic acetylcholine receptors (nAChRs) at the neuromuscular junction. It may link the receptor to the underlying postsynaptic cytoskeleton, possibly by direct association with actin or spectrin.
Form : Liquid
Molecular Mass : 48.8 kDa
AA Sequence : MGSSHHHHHHSSGLVPRGSHMGSMGQDQTKQQIEKGLQLYQSNQTEKALQVWMKVLEKGSDLVGRFRVLGCLVTAHSEMGRYKEMLKFAVVQIDTARGLEDADFLLESYLNLARSNEKLCEFHKTISYCKTCLGLPGTRAGAQLGGQVSLSMGNAFLGLSLFQKALESFEKALRYAHNNDDTMLECRVCCSLGSFYAQVKDYEKALFFPCKAAELVNDYGKGWSLKYRAMSQYHMAVAYRLLGHLGSAMECCEESMKIALQHGDRPLQALCLLCFADIHRSRGDLETAFPRYDSAMSIMTEIGNRLGQVHVLLGVAKCWMARKVQDKALDAIEKAQDLAEEVGNKLSQLKLHCLSESIYRSKGLQRELRTHVVRFHECVEETELYCGLCGESIGERNSRLQALPCSHIFHLRCLQNNGTRSCPNCRRSSMKPGFV
Purity : > 85 % by SDS-PAGE
Stability : Shelf life: one year from despatch.
Storage : Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing.
Concentration : 0.5 mg/mL (determined by Bradford assay)
Storage Buffer : 20 mM Tris-HCl buffer (pH 8.0) containing 10 % glycerol 0.4M Urea
Gene Name Rapsn receptor-associated protein of the synapse [ Mus musculus (house mouse) ]
Official Symbol Rapsn
Synonyms Rapsn; receptor-associated protein of the synapse; r; Raps; 43kDa; Nraps; rapsyn; 43 kDa receptor-associated protein of the synapse; 43 kDa postsynaptic protein; 43kDa acetylcholine receptor-associated protein; acetylcholine receptor-associated 43 kDa protein; receptor-associated protein of the synapse, 43 kDa
Gene ID 19400
mRNA Refseq NM_009023
Protein Refseq NP_033049
UniProt ID P12672

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Rapsn Products

Required fields are marked with *

My Review for All Rapsn Products

Required fields are marked with *

0
cart-icon