Recombinant Full Length Mouse Rapsn Protein, His-tagged
Cat.No. : | Rapsn-7312M |
Product Overview : | Recombinant mouse RAPSN protein, fused to His-tag at N-terminus, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-412 |
Description : | Postsynaptic protein required for clustering of nicotinic acetylcholine receptors (nAChRs) at the neuromuscular junction. It may link the receptor to the underlying postsynaptic cytoskeleton, possibly by direct association with actin or spectrin. |
Form : | Liquid |
Molecular Mass : | 48.8 kDa |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMGSMGQDQTKQQIEKGLQLYQSNQTEKALQVWMKVLEKGSDLVGRFRVLGCLVTAHSEMGRYKEMLKFAVVQIDTARGLEDADFLLESYLNLARSNEKLCEFHKTISYCKTCLGLPGTRAGAQLGGQVSLSMGNAFLGLSLFQKALESFEKALRYAHNNDDTMLECRVCCSLGSFYAQVKDYEKALFFPCKAAELVNDYGKGWSLKYRAMSQYHMAVAYRLLGHLGSAMECCEESMKIALQHGDRPLQALCLLCFADIHRSRGDLETAFPRYDSAMSIMTEIGNRLGQVHVLLGVAKCWMARKVQDKALDAIEKAQDLAEEVGNKLSQLKLHCLSESIYRSKGLQRELRTHVVRFHECVEETELYCGLCGESIGERNSRLQALPCSHIFHLRCLQNNGTRSCPNCRRSSMKPGFV |
Purity : | > 85 % by SDS-PAGE |
Stability : | Shelf life: one year from despatch. |
Storage : | Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing. |
Concentration : | 0.5 mg/mL (determined by Bradford assay) |
Storage Buffer : | 20 mM Tris-HCl buffer (pH 8.0) containing 10 % glycerol 0.4M Urea |
Gene Name | Rapsn receptor-associated protein of the synapse [ Mus musculus (house mouse) ] |
Official Symbol | Rapsn |
Synonyms | Rapsn; receptor-associated protein of the synapse; r; Raps; 43kDa; Nraps; rapsyn; 43 kDa receptor-associated protein of the synapse; 43 kDa postsynaptic protein; 43kDa acetylcholine receptor-associated protein; acetylcholine receptor-associated 43 kDa protein; receptor-associated protein of the synapse, 43 kDa |
Gene ID | 19400 |
mRNA Refseq | NM_009023 |
Protein Refseq | NP_033049 |
UniProt ID | P12672 |
◆ Recombinant Proteins | ||
RAPSN-13931M | Recombinant Mouse RAPSN Protein | +Inquiry |
RAPSN-4313H | Recombinant Human RAPSN Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RAPSN-322H | Recombinant Full Length Human RAPSN Protein, His-tagged | +Inquiry |
Rapsn-5380M | Recombinant Full Length Mouse Rapsn Protein, Myc/DDK-tagged | +Inquiry |
RAPSN-9601Z | Recombinant Zebrafish RAPSN | +Inquiry |
◆ Cell & Tissue Lysates | ||
RAPSN-2518HCL | Recombinant Human RAPSN 293 Cell Lysate | +Inquiry |
RAPSN-2517HCL | Recombinant Human RAPSN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Rapsn Products
Required fields are marked with *
My Review for All Rapsn Products
Required fields are marked with *
0
Inquiry Basket