Recombinant Full Length Mouse Receptor Expression-Enhancing Protein 5(Reep5) Protein, His-Tagged
Cat.No. : | RFL27111MF |
Product Overview : | Recombinant Full Length Mouse Receptor expression-enhancing protein 5(Reep5) Protein (Q60870) (1-185aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-185) |
Form : | Lyophilized powder |
AA Sequence : | MRERFDRFLHEKNCMTDLLAKLEAKTGVNRSFIALGVIGLVALYLVFGYGASLLCNLIGF GYPAYISMKAIESPNKDDDTQWLTYWVVYGVFSIAEFFSDLFLSWLPFYYMLKCGFLLWC MAPSPANGAEMLYRRIIRPIFLRHESQVDSVVKDVKDKAKETADAISKEVKKATVNLLGD VKKST |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Reep5 |
Synonyms | Reep5; Dp1; Receptor expression-enhancing protein 5; GP106; Polyposis locus protein 1 homolog; Protein TB2 homolog |
UniProt ID | Q60870 |
◆ Recombinant Proteins | ||
REEP5-4985R | Recombinant Rat REEP5 Protein | +Inquiry |
RFL10583BF | Recombinant Full Length Bovine Receptor Expression-Enhancing Protein 5(Reep5) Protein, His-Tagged | +Inquiry |
REEP5-2249H | Recombinant Human REEP5, His-tagged | +Inquiry |
REEP5-631H | Recombinant Human REEP5 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
REEP5-4644R | Recombinant Rat REEP5 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
REEP5-2426HCL | Recombinant Human REEP5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Reep5 Products
Required fields are marked with *
My Review for All Reep5 Products
Required fields are marked with *
0
Inquiry Basket