Recombinant Full Length Mouse Rhomboid Domain-Containing Protein 3(Rhbdd3) Protein, His-Tagged
Cat.No. : | RFL18285MF |
Product Overview : | Recombinant Full Length Mouse Rhomboid domain-containing protein 3(Rhbdd3) Protein (Q8BP97) (1-385aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-385) |
Form : | Lyophilized powder |
AA Sequence : | MHAWEAPGSLSRALPLASSVLMLLLSCLWLLGAGPSLRLAPELLMEPWQVHRLLTHALGH TALPGLLLSLLLLPTLGWWQECHLGTVRFLHNSTVLALATGLLAVLLAGLGVSGAAGGCG YMPVHLAMLAGQSHHPGWPQRTLPPWLLPWLLLALTLLLSSEPPFLQLLCGLLTGLAYAA GAFQWLELSEQRLQVLQEGVLCKSLARCWPLRLFPTPGSLGELPVTYPAGVRPATPRPPY LASSDSWPHSDGSAQLPPRLGPGQLTWKNSERGLDWAGSSFASATTMWAALDEQMLQEGI QASLLDVSVQGSQSSLWLPKPSVSSLRLQQLQHMGFPTEQAAVALAATGRVEGAVSLLVE GLVDTEALVTEGRSSPAHCTGTGAS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Rhbdd3 |
Synonyms | Rhbdd3; Rhomboid domain-containing protein 3 |
UniProt ID | Q8BP97 |
◆ Recombinant Proteins | ||
RHBDD3-5027R | Recombinant Rat RHBDD3 Protein | +Inquiry |
RHBDD3-2286H | Recombinant Human RHBDD3, GST-tagged | +Inquiry |
RHBDD3-4686R | Recombinant Rat RHBDD3 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL18285MF | Recombinant Full Length Mouse Rhomboid Domain-Containing Protein 3(Rhbdd3) Protein, His-Tagged | +Inquiry |
RFL1911RF | Recombinant Full Length Rat Rhomboid Domain-Containing Protein 3(Rhbdd3) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RHBDD3-2363HCL | Recombinant Human RHBDD3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Rhbdd3 Products
Required fields are marked with *
My Review for All Rhbdd3 Products
Required fields are marked with *
0
Inquiry Basket