Recombinant Full Length Mouse Synaptophysin-Like Protein 1(Sypl1) Protein, His-Tagged
Cat.No. : | RFL14873MF |
Product Overview : | Recombinant Full Length Mouse Synaptophysin-like protein 1(Sypl1) Protein (O09117) (1-261aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-261) |
Form : | Lyophilized powder |
AA Sequence : | MASKANMVRQRFSRLSQRMSAFQINLNPLKEPLGFIKILEWFASIFAFATCGGFKGKTEI QVNCPKVGVNKNQTVTATFGYPFRLNQASFHTPPNVSVCDVNWEKHVLIGDYSSSAQFYV TFAVFVFLYCIAALLLYVGYTNLYRDSRKLPMIDFIVTLVATFLWLVSSSAWAKALTDIK VATGHRIVEELEICNPESGVSCYFVSVTSMGSLNVSVIFGFLNMILWGGNAWFVYKETSL HSPSNTSASHSQGGGPPTSGM |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Sypl1 |
Synonyms | Sypl1; Pphn; Sypl; Synaptophysin-like protein 1; Pantophysin |
UniProt ID | O09117 |
◆ Recombinant Proteins | ||
RFL14873MF | Recombinant Full Length Mouse Synaptophysin-Like Protein 1(Sypl1) Protein, His-Tagged | +Inquiry |
RFL15934HF | Recombinant Full Length Human Synaptophysin-Like Protein 1(Sypl1) Protein, His-Tagged | +Inquiry |
SYPL1-4321C | Recombinant Chicken SYPL1 | +Inquiry |
SYPL1-4588R | Recombinant Rhesus monkey SYPL1 Protein, His-tagged | +Inquiry |
SYPL1-4404R | Recombinant Rhesus Macaque SYPL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SYPL1-1312HCL | Recombinant Human SYPL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Sypl1 Products
Required fields are marked with *
My Review for All Sypl1 Products
Required fields are marked with *