Recombinant Full Length Mouse T-Cell Antigen Cd7(Cd7) Protein, His-Tagged
Cat.No. : | RFL3074MF |
Product Overview : | Recombinant Full Length Mouse T-cell antigen CD7(Cd7) Protein (P50283) (24-210aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (24-210) |
Form : | Lyophilized powder |
AA Sequence : | QDVHQSPRLTIASEGDSVNITCSTRGHLEGILMKKIWPQAYNVIYFEDRQEPTVDRTFSGRINFSGSQKNLTITISSLQLADTGDYTCEAVRKVSARGLFTTVVVKEKSSQEAYRSQEPLQTSFSFPAAIAVGFFFTGLLLGVVCSMLRKIQIKKLCASGIKESPCVVYEDMSYSNRKTPCIPNQYQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Cd7 |
Synonyms | Cd7; T-cell antigen CD7; CD antigen CD7 |
UniProt ID | P50283 |
◆ Recombinant Proteins | ||
CD7-032H | Recombinant Human CD7 protein, His-Avi-tagged | +Inquiry |
RFL3074MF | Recombinant Full Length Mouse T-Cell Antigen Cd7(Cd7) Protein, His-Tagged | +Inquiry |
CD7-2192M | Recombinant Mouse CD7 protein, His-tagged | +Inquiry |
CD7-17C | Recombinant Cynomolgus CD7(Ala26Pro180) Protein, C-6*His-tagged | +Inquiry |
CD7-80HF | Recombinant Full Length Human CD7 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD7-2607HCL | Recombinant Human CD7 cell lysate | +Inquiry |
CD7-1368RCL | Recombinant Rat CD7 cell lysate | +Inquiry |
CD7-2518MCL | Recombinant Mouse CD7 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Cd7 Products
Required fields are marked with *
My Review for All Cd7 Products
Required fields are marked with *