Recombinant Full Length Mouse Tail-Anchored Protein Insertion Receptor Wrb(Wrb) Protein, His-Tagged
Cat.No. : | RFL9412MF |
Product Overview : | Recombinant Full Length Mouse Tail-anchored protein insertion receptor WRB(Wrb) Protein (Q8K0D7) (1-174aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-174) |
Form : | Lyophilized powder |
AA Sequence : | MSASETDRWAWLLVLSFVFGCNLLRILLPSLSSFISRVLQKDAEQESQMRAEIQGMKQEL STVNMMDEFARYARLERKINKMTDKLKTHVKARTAQLAKIKWFISVAFYILQAALMISLI WKYYSVPVAVVPSKWITPLDRLVAFPTRVAGGIGITCWILVCNKVVAIVLHPFS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Wrb |
Synonyms | Get1; Wrb; Guided entry of tail-anchored proteins factor 1; Tail-anchored protein insertion receptor WRB; Tryptophan-rich basic protein |
UniProt ID | Q8K0D7 |
◆ Recombinant Proteins | ||
WRB-6602R | Recombinant Rat WRB Protein | +Inquiry |
WRB-10205M | Recombinant Mouse WRB Protein, His (Fc)-Avi-tagged | +Inquiry |
WRB-3536C | Recombinant Chicken WRB | +Inquiry |
WRB-6258R | Recombinant Rat WRB Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL21824BF | Recombinant Full Length Bovine Tail-Anchored Protein Insertion Receptor Wrb(Wrb) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
WRB-282HCL | Recombinant Human WRB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Wrb Products
Required fields are marked with *
My Review for All Wrb Products
Required fields are marked with *
0
Inquiry Basket