Recombinant Full Length Mouse Tetraspanin-15(Tspan15) Protein, His-Tagged
Cat.No. : | RFL36182MF |
Product Overview : | Recombinant Full Length Mouse Tetraspanin-15(Tspan15) Protein (F7BWT7) (1-294aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-294) |
Form : | Lyophilized powder |
AA Sequence : | MPRGDSEQVRYCARFSYLWLKFSLIIYSTVFWLIGGLVLSVGIYAEAERQKYKTLESAFL APAIILILLGVVMFIVSFIGVLASLRDNLCLLQSFMYILGICLVMELIGGIVALIFRNQT IDFLNDNIRRGIENYYDDLDFKNIMDFVQKKFKCCGGEDYRDWSKNQYHDCSAPGPLACG VPYTCCIRNTTDVVNTMCGYKTIDKERLNAQNIIHVRGCTNAVLIWFMDNYTIMAGLLLG ILLPQFLGVLLTLLYITRVEDIILEHSVTDGLLGPGAKSRTDTAGTGCCLCYPD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Tspan15 |
Synonyms | Tspan15; Tetraspanin-15; Tspan-15; Transmembrane 4 superfamily member 15 |
UniProt ID | F7BWT7 |
◆ Recombinant Proteins | ||
TSPAN15-17505M | Recombinant Mouse TSPAN15 Protein | +Inquiry |
TSPAN15-9684M | Recombinant Mouse TSPAN15 Protein, His (Fc)-Avi-tagged | +Inquiry |
TSPAN15-2518Z | Recombinant Zebrafish TSPAN15 | +Inquiry |
TSPAN15-4813R | Recombinant Rhesus Macaque TSPAN15 Protein, His (Fc)-Avi-tagged | +Inquiry |
TSPAN15-4992H | Recombinant Human TSPAN15 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
TSPAN15-711HCL | Recombinant Human TSPAN15 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Tspan15 Products
Required fields are marked with *
My Review for All Tspan15 Products
Required fields are marked with *
0
Inquiry Basket