Recombinant Full Length Mouse Torsin-1A-Interacting Protein 2(Tor1Aip2) Protein, His-Tagged
Cat.No. : | RFL19784MF |
Product Overview : | Recombinant Full Length Mouse Torsin-1A-interacting protein 2(Tor1aip2) Protein (Q8BYU6) (1-502aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-502) |
Form : | Lyophilized powder |
AA Sequence : | MSQSLKSQNTNMSDSGCRDPVGDSQNVLENDPSINSQTQDTRVTPNNTAEAQPLQPTSDL KEDHHEIGARAQEHTDTGDRSESPEEPALEKPPLDKAELESSPSSQDTELGHHPHSEHGG GDALDLDPNCSQSDLGGRADAHLESSSVASPEGAGDRGEADEHLESSSAAPTEGAGDRGE AGQELLAEDSTDGQSLGHSNTGPGNQDSLRRRLPVPEAGSHEEETELVKEKQEVAQDTLR KTDKKSLWTYGSVFLGCLIVAVVLSSVNSYYSSPAQQVPQNPALEAFLAQFGQLKEKFPG QSSFLWQRGRKFLQKHLNASNPSEPATIIFTAAREGKETLKCLSYHVANAYTSSQKVTAV SIDGAERALQDSDTVKLLVDLELSDGFENGHKAAVVHHFESLPAGSTLIFYKYCDHENAA FKDVALVLTVLLEEETLEASVSPREIEEKVRDLLWAKFTNSESPTSYSHMDSDKLSGLWS RISHLVLPVQPVRNIEERGCLL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Tor1aip2 |
Synonyms | Tor1aip2; Ifrg15; Lull1; Torsin-1A-interacting protein 2 |
UniProt ID | Q8BYU6 |
◆ Recombinant Proteins | ||
Tor1aip2-1573M | Recombinant Mouse Tor1aip2 protein, His & T7-tagged | +Inquiry |
TOR1AIP2-683H | Recombinant Human TOR1AIP2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
TOR1AIP2-1572H | Recombinant Human TOR1AIP2 protein, His & T7-tagged | +Inquiry |
TOR1AIP2-4718R | Recombinant Rhesus Macaque TOR1AIP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
TOR1AIP2-9524M | Recombinant Mouse TOR1AIP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TOR1AIP2-865HCL | Recombinant Human TOR1AIP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Tor1aip2 Products
Required fields are marked with *
My Review for All Tor1aip2 Products
Required fields are marked with *
0
Inquiry Basket