Recombinant Full Length Mouse Transmembrane Protein 120A(Tmem120A) Protein, His-Tagged
Cat.No. : | RFL30366MF |
Product Overview : | Recombinant Full Length Mouse Transmembrane protein 120A(Tmem120a) Protein (Q8C1E7) (1-343aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-343) |
Form : | Lyophilized powder |
AA Sequence : | MQSPPPDPLGDCLRNWEDLQQDFQGIQETHRLYRLKLEELTKLQANCTNSITRQKKRLQE LALVLKKCRPSLPSESMEAAQELENQMKERQGLFFDMEAYLPKKNGLYLSLVLGNVNVTL LSKQAKFAYKDEYEKFKLYLTIILIVISFTCRFLLNSRVTDAAFNFLLVWYYCTLTIRES ILINNGSRIKGWWVFHHYVSTFLSGVMLTWPDGLMYQKFRNQFLSFSMYQSFVQFLQYYY QSGCLYRLRALGERHTMDLTVEGFQSWMWRGLTFLLPFLFFGHFWQLFNALTLFNLARDP ECKEWQVLMCGFPFLLLFLGNFFTTLRVVHQKFHSQQHGNKKD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Tmem120a |
Synonyms | Tmem120a; Net29; Tacan; Ion channel TACAN; Transmembrane protein 120A |
UniProt ID | Q8C1E7 |
◆ Recombinant Proteins | ||
RFL7647XF | Recombinant Full Length Xenopus Laevis Transmembrane Protein 120A(Tmem120A) Protein, His-Tagged | +Inquiry |
TMEM120A-3276H | Recombinant Human TMEM120A, His-tagged | +Inquiry |
TMEM120A-5770R | Recombinant Rat TMEM120A Protein, His (Fc)-Avi-tagged | +Inquiry |
TMEM120A-9283M | Recombinant Mouse TMEM120A Protein, His (Fc)-Avi-tagged | +Inquiry |
TMEM120A-16900M | Recombinant Mouse TMEM120A Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMEM120A-1011HCL | Recombinant Human TMEM120A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Tmem120a Products
Required fields are marked with *
My Review for All Tmem120a Products
Required fields are marked with *
0
Inquiry Basket