Recombinant Full Length Mouse Transmembrane Protein 91(Tmem91) Protein, His-Tagged
| Cat.No. : | RFL7838MF |
| Product Overview : | Recombinant Full Length Mouse Transmembrane protein 91(Tmem91) Protein (Q8C581) (1-172aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mus musculus |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-172) |
| Form : | Lyophilized powder |
| AA Sequence : | MDNSSIQELQQPLLPSITCDLLAPRSEKPELGTPFPETAFAESPRGWQLLLPPLPSVSAG LGEPETPDFEDTLSSDSDSDDDGGDRLSPLLPHDHLGLAVFSVLCCFWPVGIAAFCLAHK TNKAWAKGDVQGAGAASRRAFLLGVLAVGLGLCTYAAALVTLAAYLASRDPP |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | Tmem91 |
| Synonyms | Tmem91; SynDIG3; Transmembrane protein 91; Dispanin subfamily C member 3; DSPC3; Synapse differentiation-induced protein 3 |
| UniProt ID | Q8C581 |
| ◆ Recombinant Proteins | ||
| TMEM91-4659R | Recombinant Rhesus Macaque TMEM91 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Tmem91-6518M | Recombinant Mouse Tmem91 Protein, Myc/DDK-tagged | +Inquiry |
| TMEM91-406H | Recombinant Human TMEM91 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
| TMEM91-17094M | Recombinant Mouse TMEM91 Protein | +Inquiry |
| RFL7838MF | Recombinant Full Length Mouse Transmembrane Protein 91(Tmem91) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Tmem91 Products
Required fields are marked with *
My Review for All Tmem91 Products
Required fields are marked with *
