Recombinant Full Length Mouse Tumor Necrosis Factor Receptor Superfamily Member 17(Tnfrsf17) Protein, His-Tagged
Cat.No. : | RFL14549MF |
Product Overview : | Recombinant Full Length Mouse Tumor necrosis factor receptor superfamily member 17(Tnfrsf17) Protein (O88472) (1-185aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-185) |
Form : | Lyophilized powder |
AA Sequence : | MAQQCFHSEYFDSLLHACKPCHLRCSNPPATCQPYCDPSVTSSVKGTYTVLWIFLGLTLVLSLALFTISFLLRKMNPEALKDEPQSPGQLDGSAQLDKADTELTRIRAGDDRIFPRSLEYTVEECTCEDCVKSKPKGDSDHFFPLPAMEEGATILVTTKTGDYGKSSVPTALQSVMGMEKPTHTR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Tnfrsf17 |
Synonyms | Tnfrsf17; Bcm; Bcma; Tumor necrosis factor receptor superfamily member 17; B-cell maturation protein; CD antigen CD269 |
UniProt ID | O88472 |
◆ Recombinant Proteins | ||
TNFRSF17-100R | Recombinant Rhesus macaque TNFRSF17 Protein, Fc-tagged | +Inquiry |
TNFRSF17-238H | Active Recombinant Human TNFRSF17 Protein, Fc & Avi-tagged, Biotinylated | +Inquiry |
TNFRSF17-2604H | Recombinant Human TNFRSF17 | +Inquiry |
TNFRSF17-2923C | Active Recombinant Cynomolgus/Rhesus macaque TNFRSF17 protein, His-Avi-tagged, Biotinylated | +Inquiry |
TNFRSF17-2924C | Recombinant Cynomolgus TNFRSF17 protein, hFc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFRSF17-1253CCL | Recombinant Cynomolgus TNFRSF17 cell lysate | +Inquiry |
TNFRSF17-2489HCL | Recombinant Human TNFRSF17 cell lysate | +Inquiry |
TNFRSF17-1489RCL | Recombinant Rat TNFRSF17 cell lysate | +Inquiry |
TNFRSF17-2593MCL | Recombinant Mouse TNFRSF17 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Tnfrsf17 Products
Required fields are marked with *
My Review for All Tnfrsf17 Products
Required fields are marked with *