Recombinant Full Length Mouse Uroplakin-1A(Upk1A) Protein, His-Tagged
Cat.No. : | RFL30194MF |
Product Overview : | Recombinant Full Length Mouse Uroplakin-1a(Upk1a) Protein (Q9D132) (1-257aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-257) |
Form : | Lyophilized powder |
AA Sequence : | MASAATEGEKGSPVVVGLLVVGNIIILLSGLALFAETVWVTADQYRVYPLMGVSGKDDVF AGAWIAIFCGFSFFVVASFGVGAALCRRRYMILTYLLLMLIVYIFECASCITSYTHRDYM VSNPSLITKQMLTYYSADTDQGQELTRLWDRIMIEQECCGTSGPMDWVNYTSAFRAATPE VVFPWPPLCCRRTGNFIPINEDGCRVGHMDYLFTKGCFEHIGHAIDSYTWGISWFGFAIL MWTLPVMLIAMYFYTTL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Upk1a |
Synonyms | Upk1a; Uroplakin-1a; UP1a; Uroplakin Ia; UPIa; UPKa |
UniProt ID | Q9D132 |
◆ Recombinant Proteins | ||
UPK1A-3729Z | Recombinant Zebrafish UPK1A | +Inquiry |
UPK1A-5584H | Recombinant Human UPK1A Protein (His117-Gly232), N-His tagged | +Inquiry |
RFL13422HF | Recombinant Full Length Human Uroplakin-1A(Upk1A) Protein, His-Tagged | +Inquiry |
UPK1A-5109R | Recombinant Rhesus monkey UPK1A Protein, His-tagged | +Inquiry |
RFL12149BF | Recombinant Full Length Bovine Uroplakin-1A(Upk1A) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
UPK1A-723HCL | Recombinant Human UPK1A lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Upk1a Products
Required fields are marked with *
My Review for All Upk1a Products
Required fields are marked with *
0
Inquiry Basket