Recombinant Full Length Mouse Urotensin-2 Receptor(Uts2R) Protein, His-Tagged
Cat.No. : | RFL34269MF |
Product Overview : | Recombinant Full Length Mouse Urotensin-2 receptor(Uts2r) Protein (Q8VIH9) (1-385aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-385) |
Form : | Lyophilized powder |
AA Sequence : | MALSLESTSFPMLAVSRSTASELPGGFNVSHNSSWTGPTDPSSLQDLVATGVIGAVLSTM GVVGVVGNVYTLVVMCRFLRASASMYVYVVNLALADLLYLLSIPFIVATYVTKDWHFGDV GCRVLFSLDFLTMHASIFTLTIMSSERYAAVLRPLDTVQRSKGYRKLLALGTWLLALLLT LPMMLAIRLVRRGSKSLCLPAWGPRAHRTYLTLLFGTSIVGPGLVIGLLYIRLARAYWLS QQASFKQTRRLPNPRVLYLILGIVLLFWACFLPFWLWQLLAQYHQAMPLTPETARIINYL TACLTYGNSCINPFLYTLLTKNYREYLRGRQRSLGSSCRGPGSAGSFLSSRVHLQQDSGR SLSSNSQQATETLVLSPVPPNGAFV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Uts2r |
Synonyms | Uts2r; Gpr14; Urotensin-2 receptor; UR-2-R; G-protein coupled receptor 14; Urotensin II receptor; UR-II-R |
UniProt ID | Q8VIH9 |
◆ Recombinant Proteins | ||
UTS2R-1021H | Recombinant Human UTS2R Full Length Transmembrane protein(Nanodisc) | +Inquiry |
UTS2R-6141R | Recombinant Rat UTS2R Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL34269MF | Recombinant Full Length Mouse Urotensin-2 Receptor(Uts2R) Protein, His-Tagged | +Inquiry |
UTS2R-4951R | Recombinant Rhesus Macaque UTS2R Protein, His (Fc)-Avi-tagged | +Inquiry |
UTS2R-5138R | Recombinant Rhesus monkey UTS2R Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Uts2r Products
Required fields are marked with *
My Review for All Uts2r Products
Required fields are marked with *
0
Inquiry Basket