Recombinant Full Length Mouse Vang-Like Protein 2(Vangl2) Protein, His-Tagged
Cat.No. : | RFL30948MF |
Product Overview : | Recombinant Full Length Mouse Vang-like protein 2(Vangl2) Protein (Q91ZD4) (1-521aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-521) |
Form : | Lyophilized powder |
AA Sequence : | MDTESQYSGYSYKSGHSRSSRKHRDRRDRHRSKSRDGSRGDKSVTIQAPGEPLLDNESTR GDERDDNWGETTTVVTGTSEHSISHDDLTRIAKDMEDSVPLDCSRHLGVAAGAILALLSF LTPLAFLLLPPLLWREELEPCGTACEGLFISVAFKLLILLLGSWALFFRRPKASLPRVFV LRALLMVLVFLLVISYWLFYGVRILDARERSYQGVVQFAVSLVDALLFVHYLAVVLLELR QLQPQFTLKVVRSTDGASRFYNVGHLSIQRVAVWILEKYYHDFPVYNPALLNLPKSVLAK KVSGFKVYSLGEENSTNNSTGQSRAVIAAAARRRDNSHNEYYYEEAEHERRVRKRRARLV VAVEEAFTHIKRLQEEEQKNPREVMDPREAAQAIFASMARAMQKYLRTTKQQPYHTMESI LQHLEFCITHDMTPKAFLERYLAAGPTIQYHKERWLAKQWTLVSEEPVTNGLKDGIVFLL KRQDFSLVVSTKKVPFFKLSEEFVDPKSHKFVMRLQSETSV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Vangl2 |
Synonyms | Vangl2; Lpp1; Ltap; Vang-like protein 2; Loop-tail protein 1; Loop-tail-associated protein; Van Gogh-like protein 2 |
UniProt ID | Q91ZD4 |
◆ Recombinant Proteins | ||
VANGL2-6153R | Recombinant Rat VANGL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL17544XF | Recombinant Full Length Xenopus Tropicalis Vang-Like Protein 2(Vangl2) Protein, His-Tagged | +Inquiry |
RFL15741DF | Recombinant Full Length Danio Rerio Vang-Like Protein 2(Vangl2) Protein, His-Tagged | +Inquiry |
VANGL2-9481Z | Recombinant Zebrafish VANGL2 | +Inquiry |
VANGL2-3644H | Recombinant Human VANGL2, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
VANGL2-432HCL | Recombinant Human VANGL2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Vangl2 Products
Required fields are marked with *
My Review for All Vangl2 Products
Required fields are marked with *
0
Inquiry Basket