Recombinant Full Length Mouse Vesicle-Trafficking Protein Sec22A(Sec22A) Protein, His-Tagged
Cat.No. : | RFL4695MF |
Product Overview : | Recombinant Full Length Mouse Vesicle-trafficking protein SEC22a(Sec22a) Protein (Q8BH47) (1-307aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-307) |
Form : | Lyophilized powder |
AA Sequence : | MSMILSASVIRVRDGLPLSASTDYEQSTGMQECRKYFKMLSRKLAQFPDRCTLKTGRYNI NFISSLGVSYMMLCSENYPNVLAFSFLDELQKEFITTYNMMKTNTAVRPYCFIEFDNFIQ RTKQRYNNPRSLSTKINLSDMQMEIKLRPPYQIPMCELGSANGVTSAFSVDCKGAGKISS AHQRLEPATLSGIVAFILSLLCGALNLIRGFHAIESLLQSDGEDLNYIIAFFLGTAACLY QCYLLVYYTSWRNVKSFLTFGLICLCNMYLYELRNLWQLFFHVTVGAFVTLQIWLRQAQG KAPDHDV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Sec22a |
Synonyms | Sec22a; Sec22l2; Vesicle-trafficking protein SEC22a; SEC22 vesicle-trafficking protein homolog A; SEC22 vesicle-trafficking protein-like 2 |
UniProt ID | Q8BH47 |
◆ Recombinant Proteins | ||
SEC22A-2354H | Recombinant Human SEC22A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SEC22A-4959R | Recombinant Rat SEC22A Protein, His (Fc)-Avi-tagged | +Inquiry |
SEC22A-10095Z | Recombinant Zebrafish SEC22A | +Inquiry |
SEC22A-1664C | Recombinant Chicken SEC22A | +Inquiry |
RFL4695MF | Recombinant Full Length Mouse Vesicle-Trafficking Protein Sec22A(Sec22A) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SEC22A-1996HCL | Recombinant Human SEC22A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Sec22a Products
Required fields are marked with *
My Review for All Sec22a Products
Required fields are marked with *