Recombinant Full Length Mouse Zinc Transporter 3(Slc30A3) Protein, His-Tagged
Cat.No. : | RFL25863MF |
Product Overview : | Recombinant Full Length Mouse Zinc transporter 3(Slc30a3) Protein (P97441) (1-388aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-388) |
Form : | Lyophilized powder |
AA Sequence : | MEPSLATGGSETTRLVSARDRSSAGGGLRLKSLFTEPSEPLPEEPKLEGMAFHHCHKDPV PQSGLSPERVQARRQLYAACAVCFIFMAGEVVGGYLAHSLAIMTDAAHLLADIGSMLASL FSLWLSTRPATRTMTFGWHRSETLGALASVVSLWIVTGILLYLAFLRLLHSDYHIEAGAM LLTASIAVCANLLMAFVLHQTGAPHSHGSTGAEYAPLEEGHGYPMSLGNTSVRAAFVHVL GDLLQSFGVLAASILIYFKPQYKVADPISTFLFSICALGSTAPTLRDVLLVLMEGAPRSV EFEPVRDTLLSVPGVRATHDLHLWALTLTYHVASAHLAIDSTADPEAVLAEASSRLYSRF GFSSCTLQVEQYQPEMAQCLRCQEPSQA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Slc30a3 |
Synonyms | Slc30a3; Znt3; Zinc transporter 3; ZnT-3; Solute carrier family 30 member 3 |
UniProt ID | P97441 |
◆ Recombinant Proteins | ||
RFL19347RF | Recombinant Full Length Rat Zinc Transporter 3(Slc30A3) Protein, His-Tagged | +Inquiry |
SLC30A3-0578H | Recombinant Human SLC30A3 Protein (E2-A388), 8×His-MBP, Flag tagged | +Inquiry |
Slc30a3-5926M | Recombinant Mouse Slc30a3 Protein, Myc/DDK-tagged | +Inquiry |
SLC30A3-5162R | Recombinant Rat SLC30A3 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL25863MF | Recombinant Full Length Mouse Zinc Transporter 3(Slc30A3) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC30A3-1738HCL | Recombinant Human SLC30A3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Slc30a3 Products
Required fields are marked with *
My Review for All Slc30a3 Products
Required fields are marked with *
0
Inquiry Basket