Recombinant Full Length Mouse Zona Pellucida Sperm-Binding Protein 3(Zp3) Protein, His-Tagged
Cat.No. : | RFL8385MF |
Product Overview : | Recombinant Full Length Mouse Zona pellucida sperm-binding protein 3(Zp3) Protein (P10761) (23-351aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (23-351) |
Form : | Lyophilized powder |
AA Sequence : | QTLWLLPGGTPTPVGSSSPVKVECLEAELVVTVSRDLFGTGKLVQPGDLTLGSEGCQPRVSVDTDVVRFNAQLHECSSRVQMTKDALVYSTFLLHDPRPVSGLSILRTNRVEVPIECRYPRQGNVSSHPIQPTWVPFRATVSSEEKLAFSLRLMEENWNTEKSAPTFHLGEVAHLQAEVQTGSHLPLQLFVDHCVATPSPLPDPNSSPYHFIVDFHGCLVDGLSESFSAFQVPRPRPETLQFTVDVFHFANSSRNTLYITCHLKVAPANQIPDKLNKACSFNKTSQSWLPVEGDADICDCCSHGNCSNSSSSQFQIHGPRQWSKLVSRNRRHVTDEADVTVGPLIFLGKAN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Zp3 |
Synonyms | Zp3; Zp-3; Zpc; Zona pellucida sperm-binding protein 3; Sperm receptor; Zona pellucida glycoprotein 3; Zona pellucida protein C |
UniProt ID | P10761 |
◆ Recombinant Proteins | ||
RFL15622OF | Recombinant Full Length Rabbit Zona Pellucida Sperm-Binding Protein 3(Zp3) Protein, His-Tagged | +Inquiry |
ZP3-10495M | Recombinant Mouse ZP3 Protein, His (Fc)-Avi-tagged | +Inquiry |
ZP3-8918Z | Recombinant Zebrafish ZP3 | +Inquiry |
RFL30192GF | Recombinant Full Length Chicken Zona Pellucida Sperm-Binding Protein 3(Zp3) Protein, His-Tagged | +Inquiry |
ZP3-19225M | Recombinant Mouse ZP3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZP3-2099HCL | Recombinant Human ZP3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Zp3 Products
Required fields are marked with *
My Review for All Zp3 Products
Required fields are marked with *
0
Inquiry Basket