Recombinant Full Length Oryza Sativa Subsp. Japonica Phosphoenolpyruvate/Phosphate Translocator 1, Chloroplastic(Ppt1) Protein, His-Tagged
Cat.No. : | RFL8989OF |
Product Overview : | Recombinant Full Length Oryza sativa subsp. japonica Phosphoenolpyruvate/phosphate translocator 1, chloroplastic(PPT1) Protein (Q69VR7) (67-408aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rice |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (67-408) |
Form : | Lyophilized powder |
AA Sequence : | ASPEQEDERRRGARDVAVAATAAAAGEAGAEEGGGLAKTLQLGALFGLWYLFNIYFNIYN KQVLKVFPYPINITNVQFAVGTVIALFMWITGILKRPKISGAQLAAILPLAMVHTMGNLF TNMSLGKVAVSFTHTIKAMEPFFSVLLSALFLGEMPTPFVVLSLVPIVGGVALASLTEAS FNWAGFWSAMASNVTFQSRNVLSKKLMVKKEESLDNITLFSIITVMSFFLLAPVTLLTEG VKVTPTVLQSAGLNLKQIYTRSLIAAFCFHAYQQVSYMILARVSPVTHSVGNCVKRVVVI VTSVLFFRTPVSPINSLGTGVALAGVFLYSQLKRLKPKPKTA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | PPT1 |
Synonyms | PPT1; Os09g0297400; LOC_Os09g12600; OJ1381_H04.7; OsJ_28749; P0592C05.31; Phosphoenolpyruvate/phosphate translocator 1, chloroplastic; OsPPT1 |
UniProt ID | Q69VR7 |
◆ Recombinant Proteins | ||
PPT1-12524Z | Recombinant Zebrafish PPT1 | +Inquiry |
PPT1-29543TH | Recombinant Full Length Human PPT1 Protein, GST-tagged | +Inquiry |
PPT1-367H | Recombinant Full Length Human PPT1, His-tagged | +Inquiry |
PPT1-366H | Recombinant Human PPT1, Fc-tagged | +Inquiry |
PPT1-13281M | Recombinant Mouse PPT1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PPT1-001HCL | Recombinant Human PPT1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PPT1 Products
Required fields are marked with *
My Review for All PPT1 Products
Required fields are marked with *
0
Inquiry Basket