Recombinant Full Length Oryza Sativa Subsp. Japonica Phosphoenolpyruvate/Phosphate Translocator 2, Chloroplastic(Ppt2) Protein, His-Tagged
Cat.No. : | RFL33947OF |
Product Overview : | Recombinant Full Length Oryza sativa subsp. japonica Phosphoenolpyruvate/phosphate translocator 2, chloroplastic(PPT2) Protein (Q84QU8) (52-407aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rice |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (52-407) |
Form : | Lyophilized powder |
AA Sequence : | AVAARSLGRLLLLPPPPPISPDRAGRGRARHVACGAAAGDAKAEEEESGLAKTLQLGALF GLWYLFNIYFNIYNKQVLKVFPYPINITTVQFAVGTVVALFMWITGILRRPKISGAQLFA ILPLAVVHTMGNLFTNMSLGKVAVSFTHTIKAMEPFFSVLLSAIFLGELPTVWVILSLLP IVGGVALASLTEASFNWAGFWSAMASNVTFQSRNVLSKKLMVKKEESLDNINLFSIITVM SFFLLAPVAFLTEGIKITPTVLQSAGLNVKQVLTRSLLAALCFHAYQQVSYMILARVSPV THSVGNCVKRVVVIVTSVLFFRTPVSPINSLGTAIALAGVFLYSQLKRLKPKPKAA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | PPT2 |
Synonyms | PPT2; Os08g0344600; LOC_Os08g25624; OJ1119_B10.35; P0410E11.104; Phosphoenolpyruvate/phosphate translocator 2, chloroplastic; OsPPT2 |
UniProt ID | Q84QU8 |
◆ Recombinant Proteins | ||
PPT2-1930H | Recombinant Human PPT2, His-tagged | +Inquiry |
PPT2-7051M | Recombinant Mouse PPT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
PPT2-4307R | Recombinant Rat PPT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
PPT2-13282M | Recombinant Mouse PPT2 Protein | +Inquiry |
PPT2-6077Z | Recombinant Zebrafish PPT2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
PPT2-2905HCL | Recombinant Human PPT2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PPT2 Products
Required fields are marked with *
My Review for All PPT2 Products
Required fields are marked with *