Recombinant Full Length Oryza Sativa Subsp. Japonica Secretory Carrier-Associated Membrane Protein 3(Scamp3) Protein, His-Tagged
Cat.No. : | RFL11266OF |
Product Overview : | Recombinant Full Length Oryza sativa subsp. japonica Secretory carrier-associated membrane protein 3(SCAMP3) Protein (Q60EA5) (1-282aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rice |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-282) |
Form : | Lyophilized powder |
AA Sequence : | MAGKHGRNGFEDDDVNPFAGGSVPPANNSRLPPLSHEPADFYNVDIPLDSSKDLKKKEKE LQAMEAELNKRERELKRKEEAAAQAGIVIEDKNWPPFFPLIHHNISNEIPIHLQRMQYLA FSSFLGLAACLFWNIIATTTAWVKGEGVIIWLLAIIYFISGVPGAYVLWYRPLYNAMRTE SALKFGWFFLFYLIHIIFCVWAAVAPPFPFKGKSLAGILPAIDVIGRSAIVGIFYFVGFG LFCLESLLSIGVIQQVYMYFRGSGKAAEMKREAARGALSSAF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SCAMP3 |
Synonyms | SCAMP3; Os05g0503000; LOC_Os05g42330; OsJ_19111; OSJNBa0017K09.16; OSJNBb0048K05.1; Secretory carrier-associated membrane protein 3; Secretory carrier membrane protein 3 |
UniProt ID | Q60EA5 |
◆ Recombinant Proteins | ||
SCAMP3-3457H | Recombinant Human SCAMP3 protein, His-tagged | +Inquiry |
SCAMP3-1734Z | Recombinant Zebrafish SCAMP3 | +Inquiry |
SCAMP3-2521H | Recombinant Human SCAMP3, GST-tagged | +Inquiry |
SCAMP3-7920M | Recombinant Mouse SCAMP3 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL27186BF | Recombinant Full Length Bovine Secretory Carrier-Associated Membrane Protein 3(Scamp3) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SCAMP3-2047HCL | Recombinant Human SCAMP3 293 Cell Lysate | +Inquiry |
SCAMP3-2048HCL | Recombinant Human SCAMP3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SCAMP3 Products
Required fields are marked with *
My Review for All SCAMP3 Products
Required fields are marked with *
0
Inquiry Basket