Recombinant Full Length Pan Troglodytes C5A Anaphylatoxin Chemotactic Receptor(C5Ar1) Protein, His-Tagged
Cat.No. : | RFL31141PF |
Product Overview : | Recombinant Full Length Pan troglodytes C5a anaphylatoxin chemotactic receptor(C5AR1) Protein (P79240) (1-340aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pan troglodytes |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-340) |
Form : | Lyophilized powder |
AA Sequence : | TPDYGHYDDKDTLDLNTPVDKTSNTLRVPDILALVIFAVVFLVGVLGNALVVWVTAFEAK RTINAIWFLNLAVADFLSCLALPILFTSIVQHHHWPFGGAACSILPSLILLNMYASILLL ATISADRFLLVFKPIWCQNFRGAGLAWIACAVAWGLALLLTIPSFLYRVVREEYFPPKVL CGVDYSHDKRRERAVAIVRLVLGFLWPLLTLMICYTFILLRTWSRRATRSTKTLKVVVAV VASFFIFWLPYQVTGIMMSFLEPSSPTFRLLNKLDSLCVSFAYINCCINPIIYVVAGQGF QGRLQKSLPSLLRNVLTEESVVRESKSFTRSTVDTMAQKT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | C5AR1 |
Synonyms | C5AR1; C5AR; C5R1; C5a anaphylatoxin chemotactic receptor 1; C5a anaphylatoxin chemotactic receptor; C5a-R; C5aR; CD antigen CD88 |
UniProt ID | P79240 |
◆ Recombinant Proteins | ||
C5AR1-1053R | Recombinant Rat C5AR1 Protein | +Inquiry |
C5ar1-734M | Recombinant Mouse C5ar1 Protein, MYC/DDK-tagged | +Inquiry |
C5AR1-0078H | Recombinant Human C5AR1 Protein | +Inquiry |
RFL31141PF | Recombinant Full Length Pan Troglodytes C5A Anaphylatoxin Chemotactic Receptor(C5Ar1) Protein, His-Tagged | +Inquiry |
C5AR1-1482H | Recombinant Human C5AR1 Full Length Transmembrane protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
C5AR1-8019HCL | Recombinant Human C5AR1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C5AR1 Products
Required fields are marked with *
My Review for All C5AR1 Products
Required fields are marked with *