Recombinant Full Length Pan Troglodytes Mas-Related G-Protein Coupled Receptor Member X2(Mrgprx2) Protein, His-Tagged
| Cat.No. : | RFL27041PF |
| Product Overview : | Recombinant Full Length Pan troglodytes Mas-related G-protein coupled receptor member X2(MRGPRX2) Protein (Q4QXX9) (1-329aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Pan troglodytes |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-329) |
| Form : | Lyophilized powder |
| AA Sequence : | MDPTTPAWGTESTTMNGNDQALPLFCGKETLISVFLILFIALVGLVGNGFVLWLLGFRMR RNAFSVYVLSLAGADFLFLCFQIINCLVYLSNVFCSISINFPSFFITVMTCAYLAGLSML STISTERCLSVLWPIWYRCRRPRHLSAVACVLLWALSLLLSILEGKFCGLFGDGDSGWCQ TFDLITAAWLIFLFMVLCGSSLALLVRILCGSRGLPLTRLYLTILLTVLVFLLCGLPFGI QWFLILWIWKNSDVLFCHIHPVSVVLSSLNSSANPIIYFFVGSFRKQWRLQQPILKLALQ RALQDIAEVDHSEGCFRQGTPEMSRSSLV |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | MRGPRX2 |
| Synonyms | MRGPRX2; MRGX2; Mas-related G-protein coupled receptor member X2 |
| UniProt ID | Q4QXX9 |
| ◆ Recombinant Proteins | ||
| MRGPRX2-5544H | Recombinant Human MRGPRX2 Protein | +Inquiry |
| MRGPRX2-6367HF | Recombinant Full Length Human MRGPRX2 Protein, GST-tagged | +Inquiry |
| RFL21619MF | Recombinant Full Length Macaca Mulatta Mas-Related G-Protein Coupled Receptor Member X2(Mrgprx2) Protein, His-Tagged | +Inquiry |
| MRGPRX2-1043H | Recombinant Human MRGPRX2 Full Length Transmembrane protein, His-tagged | +Inquiry |
| MRGPRX2-3532H | Recombinant Human MRGPRX2 Full Length Transmembrane protein(Nanodisc), His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MRGPRX2-4204HCL | Recombinant Human MRGPRX2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MRGPRX2 Products
Required fields are marked with *
My Review for All MRGPRX2 Products
Required fields are marked with *



